(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE151

CP001994.PE151       Location/Qualifiers
FT   CDS_pept        183262..183762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0154"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: glo:Glov_0131 hypothetical protein; SPTR:
FT                   B7R091 Putative uncharacterized protein; PFAM: Predicted
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35689"
FT                   /db_xref="GOA:D5E938"
FT                   /db_xref="UniProtKB/TrEMBL:D5E938"
FT                   /protein_id="ADE35689.1"
FT                   /translation="MNAAVLLINGMALAGILIAFMDDRTKAILSINIAFKGFMQILPVT
FT                   LAIIIVIALFLGFVPPEQLSAFIGEQSGISGVLLIGIAGAIMHIPAILSFPLAASLLEK
FT                   GISYTAVAALITTLTMIGTVTLPLEISQLGKKFALLRNGISFVIAIIIALLVGVAMEAT
FT                   LWH"
     atgaacgccg ctgtccttct tataaacggt atggctctgg caggtatctt aattgctttt        60
     atggacgaca ggacaaaagc aatcctttca atcaacattg catttaaagg attcatgcaa       120
     attctgcctg tgacattggc cataatcatt gtgattgctt tgttccttgg ttttgttcct       180
     cctgaacagt tatctgcatt catcggtgag cagtccggga taagtggtgt tctgttaatc       240
     gggattgcag gggctattat gcacatccct gcaatacttt cgtttcctct ggctgcttct       300
     ctgctcgaaa aaggaatctc ttataccgca gtagccgctt tgatcacaac tttgacaatg       360
     attggtacgg taacattacc cctggaaata agccaactcg gaaaaaaatt tgcactcctt       420
     cgaaatggaa taagttttgt tattgccatt attattgctt tactggtggg agtggcaatg       480
     gaggcaacgt tatggcattg a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page