(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE153

CP001994.PE153       Location/Qualifiers
FT   CDS_pept        184572..185654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0156"
FT                   /product="periplasmic binding protein"
FT                   /note="COGs: COG0614 ABC-type Fe3+-hydroxamate transport
FT                   system periplasmic component; InterPro IPR002491; KEGG:
FT                   sfu:Sfum_3702 periplasmic binding protein; PFAM:
FT                   periplasmic binding protein; SPTR: Q12YJ3 ABC
FT                   Fe3+-siderophore transporter, substrate binding subunit;
FT                   PFAM: Periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35691"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D5E940"
FT                   /protein_id="ADE35691.1"
FT                   /translation="MHKKFRYILLIFIILFAVYTSACVDQKEVSAQSTRSITDMAGRTV
FT                   EIPADVDKAITTSPPATMLIYMLAPEKLAGWNFMPQESETYLKPEYRAVPVIGGWFGKQ
FT                   DGNYETIISMGPDIIFEGYTSCGDVNSTINERQKKFGTIPVVGIEATTDATAYEEPIRF
FT                   MGEILGENERAGLLISFYKETLDTVTTKTSRIPEEEKKRVYYAEGPDGLLTDPKGSAHS
FT                   QLIEVCGGINVAQCPIEQGYGRSEVSIEQVLQWDPEVIITGDRNFYKNVYEDPLWQDIT
FT                   AVKNDEVYLFPDAPFCWFDRPPGVNRIIGIPWTAKVLYPQEFSDLDLRGNVKEFYSEFY
FT                   HYELSEDEIDDLLDPASGAN"
     atgcataaaa aattcaggta tatcctattg atatttatta tcttgtttgc ggtatataca        60
     agcgcatgcg tagaccaaaa ggaagtttct gcgcagagca caagatcgat aacggatatg       120
     gcaggaagga cagttgaaat cccggctgac gttgacaagg caattacaac ctctcctcct       180
     gcaacaatgc tcatttacat gctggctcca gaaaaattgg caggctggaa ttttatgcca       240
     caggagtcgg aaacatatct gaaacctgaa taccgggctg ttcctgtgat cggtggatgg       300
     tttggtaagc aggatggaaa ttatgaaact attatctcca tgggtcccga tatcatcttt       360
     gaaggctaca ccagttgtgg ggatgttaat tctaccatca atgaaagaca gaaaaaattc       420
     ggtacaattc cggttgtagg tattgaagcg acaactgatg ccacagccta tgaagaacca       480
     atacgattta tgggtgaaat tctcggggaa aatgagcggg caggactttt gatctccttc       540
     tataaagaaa cacttgacac tgtcactaca aaaacatccc ggatacctga agaggaaaag       600
     aaacgggtct attatgcaga gggtccggat gggctgctta cggatcctaa aggttctgcg       660
     cacagtcagt tgatagaggt atgtggtggt atcaatgtag ctcagtgtcc cattgagcag       720
     ggttatggaa gatcagaggt atccatcgaa caggtattgc aatgggatcc cgaagttatc       780
     atcacaggcg accgaaattt ttacaaaaat gtatatgaag accccctatg gcaggatatt       840
     actgcggtaa aaaacgatga ggtatatctt ttcccggatg caccattttg ctggtttgac       900
     aggccacctg gtgttaacag gataatcggt attccttgga cagctaaagt gctctatcct       960
     caagagttca gcgatcttga tctcaggggc aatgttaagg aattctattc agagttctat      1020
     cattatgaac tgtcggaaga tgagatcgat gatttattgg atccagcttc tggagcaaat      1080
     tga                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page