(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE157

CP001994.PE157       Location/Qualifiers
FT   CDS_pept        189193..189963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0160"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1120 ABC-type cobalamin/Fe3+-siderophores
FT                   transport systems ATPase components; InterPro
FT                   IPR003439:IPR003593:IPR017871; KEGG: ppd:Ppro_1463 ABC
FT                   transporter related; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: Q12YJ7 ABC Fe3+-siderophore transporter,
FT                   ATPase subunit; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35695"
FT                   /db_xref="GOA:D5E944"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E944"
FT                   /protein_id="ADE35695.1"
FT                   /translation="MILRVDNASYSYDGKKNVFEDISFFLKKGETLCILGPNGIGKSTL
FT                   LKCLGNVLKLSEGSVLIDGNDISSMSRTEIAQKIGYVPQSDQSVFPFSVLDFVMLGRAP
FT                   HLPFFSSPGEKDLRIAGNAISKVGISHLRDRPVTEVSGGERQLALIARALAQEPEILLL
FT                   DEPTSHLDFGNQVRVLNLIERLTSQGTSVIMSTHFPDHGFIGSKNVAIMLENDFIEQGT
FT                   AEEVITKENMALAYGVDVAIDHVSSIQRNVCLPL"
     atgatattaa gagtagacaa tgcttcatat tcgtatgatg ggaagaagaa tgtatttgag        60
     gatatttcct tttttttaaa aaagggtgag actttatgca tacttggtcc caatgggatt       120
     ggtaaatcca cattgctaaa atgtctcggc aatgtattaa aattaagtga gggcagcgtc       180
     cttattgatg ggaatgatat ctcttctatg agcaggactg agattgccca aaagataggt       240
     tacgttccac agtctgatca atcggtattt cctttttctg tactggattt tgtaatgctt       300
     ggcagggcgc ctcatcttcc ctttttctca tctccgggag aaaaggacct ccggattgcc       360
     gggaatgcca tcagtaaagt gggaatctcc catttgaggg acaggcctgt tacagaagta       420
     agcggtggcg aaagacaact tgctttaatt gcaagggctc tggcacagga gccggaaatt       480
     ttgcttctgg atgaacctac atcccatctg gatttcggga atcaggtacg tgttctgaac       540
     cttattgaaa ggcttacctc tcagggaact tctgtaatta tgagcactca ctttccggat       600
     catggtttta taggctctaa gaatgtagcg ataatgctcg agaacgattt catagaacag       660
     gggaccgctg aagaagtaat tacaaaagag aacatggccc ttgcatatgg tgtcgatgta       720
     gctatcgatc atgtcagttc catacagaga aatgtatgtc ttcctcttta a                771
//

If you have problems or comments...

PBIL Back to PBIL home page