(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE159

CP001994.PE159       Location/Qualifiers
FT   CDS_pept        complement(191927..192724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0162"
FT                   /product="CRISPR-associated protein Cas4"
FT                   /note="InterPro IPR013343; KEGG: DNA2; DNA helicase,
FT                   ssDNA-dependent ATPase, and endonuclease; K10742 DNA
FT                   replication ATP-dependent helicase Dna2; PFAM:
FT                   CRISPR-associated protein Cas4; SPTR: Q12UR5 Putative
FT                   uncharacterized protein; TIGRFAM: CRISPR-associated protein
FT                   Cas4; PFAM: Domain of unknown function DUF83; TIGRFAM:
FT                   CRISPR-associated protein Cas4"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35697"
FT                   /db_xref="GOA:D5E946"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="UniProtKB/TrEMBL:D5E946"
FT                   /protein_id="ADE35697.1"
FT                   /translation="MCAMFCETNSNVSEVVLYTKCPRKIYFTSRNEVISNEIEKPYIRH
FT                   LLLKELALSCAEIAVSKQEILPLLQKRVEEIVQEIITIYSDELEHIDENQFKDALEDVY
FT                   EVLPAIAGNLKNQFDEEMIELIKPVEIEPLMHSDKLNLSGAPSAIICSDKQKIPMLIKT
FT                   GNAPMQGVWKNDRIPLAAYSILTEERYDQPVNSAVLFYASQGQARSVRIRPAERREVLN
FT                   ILKRIEKIKEGKMPQAKRGKLCGYCPYEQMCQSQGDSLASKFF"
     atgtgtgcaa tgttctgcga aacaaattcc aatgtttcgg aagtggttct ctacacgaag        60
     tgcccccgca agatatactt taccagcagg aatgaagtaa tatcaaatga aattgaaaaa       120
     ccttacatcc gtcatttgct gctaaaagaa ctggctcttt cctgtgcaga gattgccgta       180
     tcaaagcagg aaatactccc acttctgcaa aagcgggtcg aagagattgt acaggaaata       240
     ataaccattt attccgacga attggagcac atcgatgaaa accaattcaa agatgcattg       300
     gaagatgtat acgaagtttt gcctgcaata gcgggcaatt taaagaacca attcgatgaa       360
     gaaatgatcg aattaataaa acccgttgaa atcgaacccc tgatgcattc ggataaatta       420
     aacttaagtg gtgcaccatc ggcaatcatc tgttccgata aacagaagat tcccatgctc       480
     ataaaaaccg gtaatgcccc aatgcagggt gtttggaaaa atgaccggat acctctggca       540
     gcctattcca tacttacaga agaaagatac gaccaaccgg taaattccgc agttcttttt       600
     tatgcctcgc agggccaggc aagatctgtg agaattcgcc cagctgagcg cagggaggtt       660
     cttaatatcc tcaaacgaat tgaaaagata aaggaaggaa agatgccaca ggcaaagcgg       720
     ggaaagctct gtggatactg tccatacgaa cagatgtgtc aatcacaggg cgattcactg       780
     gcttcaaagt tcttctga                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page