(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE16

CP001994.PE16        Location/Qualifiers
FT   CDS_pept        complement(15845..16813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0016"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="COGs: COG3448 CBS-domain-containing membrane
FT                   protein; InterPro IPR000644; KEGG: dde:Dde_0765 CBS; PFAM:
FT                   CBS domain containing protein; SMART: CBS domain containing
FT                   protein; SPTR: Q12V75 CBS domain protein; PFAM: CBS domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35554"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8P5"
FT                   /protein_id="ADE35554.1"
FT                   /translation="MSSRQKNTGNPGGTDISKDPKAYSMESIMDRGNVNFKARIAEHEG
FT                   SMMAVATKDVISANPTTPIIDVIKKMSKMHFKHMPIVNAGTSKLEGIITSVDIMDLLGG
FT                   GERSLFVEKKFKGNLLSAINAQVRYIMEHEVHSLRNDAHIEKAFELMIDKQIGCIPVVD
FT                   NDGHLEAICTERDFLTFIRGVLTGKKVEKWQTRNVKTADAATSIWDVARTMIENKFKRV
FT                   PIVRDNILVGVVTSSDILSYLGTGEAFEKLTTGNVHEAFDSPISSLLHNDLIWTIPDAD
FT                   LGEAAEIMLEKSIGCLPIIKDGNLEGILTERDILLALADKQ"
     atgagttcca gacaaaaaaa taccggtaac ccaggaggga cagatatcag caaggatcca        60
     aaggcctaca gcatggagag tataatggac aggggaaatg ttaatttcaa ggctcgtata       120
     gccgaacatg agggaagtat gatggctgtt gcaacaaaag atgttatttc cgcaaacccc       180
     actactccca taatagatgt cattaaaaaa atgagcaaga tgcatttcaa gcatatgcct       240
     attgtcaatg cagggacatc aaaacttgaa ggtataatca cttcagtgga tataatggac       300
     ctactgggtg gaggagaaag aagccttttc gtggagaaaa aattcaaagg taacctgctt       360
     tcagctataa atgcacaggt gcgctacata atggaacatg aagtccacag tctgcgcaac       420
     gatgcacata ttgaaaaggc cttcgagttg atgatagaca aacagatcgg ctgcatccct       480
     gtagtggaca atgatggtca tctggaagca atctgcacag aaagggattt ccttaccttt       540
     ataagaggag tactgaccgg gaaaaaggtc gaaaaatggc agaccagaaa tgtcaaaact       600
     gcggatgcag caacttcaat ctgggatgtt gccaggacaa tgattgagaa taagttcaaa       660
     agagttccta ttgtcaggga taatatactt gtgggagttg ttacatcttc cgacattctc       720
     agttatctgg gaaccgggga agcttttgaa aaactcacca cgggtaacgt ccatgaggct       780
     ttcgacagcc cgattagctc tctcttgcat aatgatctta tttggacaat accggatgct       840
     gatctcgggg aagcagcaga aattatgctt gaaaaaagca taggatgtct tcctataata       900
     aaagatggta atctggaggg aatcctgaca gaaagggata tcctgcttgc actggcagac       960
     aaacaataa                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page