(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE164

CP001994.PE164       Location/Qualifiers
FT   CDS_pept        196249..196764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0167"
FT                   /product="adenylyl cyclase CyaB"
FT                   /note="COGs: COG1437 Adenylate cyclase class 2
FT                   (thermophilic); InterPro IPR008172:IPR008173; KEGG:
FT                   vpa:VP1760 putative adenylate cyclase; PFAM: adenylate
FT                   cyclase; SPTR: Q12UR0 Adenylate cyclase; TIGRFAM: adenylyl
FT                   cyclase CyaB; PFAM: CYTH domain; TIGRFAM: adenylyl cyclase
FT                   CyaB, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35702"
FT                   /db_xref="InterPro:IPR008173"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:D5E951"
FT                   /protein_id="ADE35702.1"
FT                   /translation="MLEVEVKSRITLSHAREVLDRLDAKFLETEEHFDIYYNAPHRDFA
FT                   ETDEALRIRSVNDRQVLTYKGKKLDEVTKSREEIQTHVEAEAMIHILERLGFKETARVQ
FT                   KVRDVFKIGDITLCLDEVDSLGQFIEFEIISDADMEESKKRIFAMMENFGLKPEDSIRK
FT                   SYLELVME"
     atgcttgagg tagaagtaaa atcccgtatc accctctccc atgctcgtga agttcttgac        60
     aggctggatg caaaattcct ggagacagag gagcattttg atatttacta taatgctccg       120
     caccgggatt ttgcagaaac ggacgaagct ttgcgtatac gttctgttaa tgacaggcag       180
     gtcctgacct acaagggtaa aaaactggac gaagtaacca aaagtcgtga ggagatccag       240
     actcatgtgg aagccgaagc catgatacat attctggaaa gacttggttt caaagaaact       300
     gcgagggtcc agaaggtgag ggatgttttc aaaataggag acatcacctt atgtctggac       360
     gaagtggatt ccctgggtca gttcatcgaa tttgagataa tctcggatgc tgatatggaa       420
     gaaagcaaaa aacgcatttt tgcgatgatg gaaaattttg gcctgaaacc cgaggattcc       480
     atccgtaaat cctatctgga actcgttatg gagtaa                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page