(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE169

CP001994.PE169       Location/Qualifiers
FT   CDS_pept        complement(202324..203250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0172"
FT                   /product="ribose 1,5-bisphosphate isomerase"
FT                   /EC_number="5.3.1.23"
FT                   /EC_number="5.3.1.-"
FT                   /note="COGs: COG1184 Translation initiation factor 2B
FT                   subunit eIF-2B alpha/beta/delta family; InterPro
FT                   IPR000649:IPR011559:IPR005250; KEGG: gur:Gura_4322 aIF-2BI
FT                   family translation initiation factor; PFAM: initiation
FT                   factor 2B related; PRIAM: S-methyl-5-thioribose-1-phosphate
FT                   isomerase; SPTR: Q12UQ7 Ribose 1,5-bisphosphate isomerase;
FT                   TIGRFAM: translation initiation factor, aIF-2BII family;
FT                   eIF-2B alpha/beta/delta-related uncharacterized protein;
FT                   PFAM: Initiation factor 2 subunit family; TIGRFAM: eIF-2B
FT                   alpha/beta/delta-related uncharacterized proteins;
FT                   ribose-1,5-bisphosphate isomerase, e2b2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35707"
FT                   /db_xref="GOA:D5E956"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005250"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/TrEMBL:D5E956"
FT                   /protein_id="ADE35707.1"
FT                   /translation="MQQLLDTAEKIRSMEIRGAGRIATAAAKALRDYVEMLETSSFEEF
FT                   VAKVEKAKSILIETRPTAVSLPNAVMLAGSYDAETVEEARSQILDNATEFIRNADNALD
FT                   NIGEIGAKRLRDGDTVMTHCNSHAALAIIKTAHKQGKRIKVYATESRPRRQGFITIKEL
FT                   SDAGIDTTLIVDSAVRYTMKNVDTVIVGADSITVNGALVNKIGTSQLALAAHEARVNFI
FT                   SAAETYKFSPSTLFGDLVEIEERDPDEVIPSDKLGDMPDVKISNPAFDVTPSEYIDLIV
FT                   TEAGAFPPEMAYVIIKEHLGWELKKMG"
     atgcagcagt tactcgacac ggctgaaaag atacggtcaa tggagattcg cggggcaggc        60
     agaattgcaa ctgcagctgc taaggcactg cgggattatg tggaaatgct ggaaacctcg       120
     tcctttgaag aatttgtagc gaaagtagaa aaagccaaat ccattcttat tgaaacccga       180
     cccacagctg tctcccttcc caatgcggta atgctggcgg gcagttatga tgcagaaact       240
     gtggaagagg cacgcagcca gatcctagat aatgccacag aatttatccg aaacgccgac       300
     aatgcccttg ataacatagg agagatcggt gcaaaacgcc tccgggacgg ggataccgtc       360
     atgacccact gcaattccca tgcagccctt gcaatcataa aaaccgccca caagcaggga       420
     aagagaataa aagtttatgc gaccgagtcc cgacctcgca gacagggatt tattacaata       480
     aaagaactca gtgacgccgg aattgacaca accctcatcg tagactcggc agtgcgatat       540
     acaatgaaaa atgtggacac tgtaatagtg ggtgcagatt caataaccgt aaatggtgct       600
     cttgttaaca agatcggtac atcccagctg gccctggcag cccatgaagc acgtgtcaac       660
     ttcatatctg cagccgagac ctacaaattc agtccttcta ccctttttgg tgacctggtg       720
     gaaatagagg aacgtgaccc tgatgaagtt attcccagcg ataaacttgg tgatatgcca       780
     gatgttaaaa taagcaaccc tgcctttgat gtcacaccat cagaatatat tgacctgatc       840
     gtgaccgaag cgggagcgtt tcccccggag atggcctatg tgataataaa agaacacctg       900
     ggctgggaac tgaaaaaaat gggatga                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page