(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE17

CP001994.PE17        Location/Qualifiers
FT   CDS_pept        complement(16902..17654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0017"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="COGs: COG3448 CBS-domain-containing membrane
FT                   protein; InterPro IPR000644; KEGG: rpa:RPA4246
FT                   CBS/transport-associated domain-containing protein; PFAM:
FT                   CBS domain containing protein; SMART: CBS domain containing
FT                   protein; SPTR: Q12V74 CBS domain protein; PFAM: CBS domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35555"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8P6"
FT                   /protein_id="ADE35555.1"
FT                   /translation="MSGDAVYLHESDTVTHARQLMRDHFLRGIPVVNDNGKVSGMITDK
FT                   DILKVASTKSNVTVAGFVNSVPQITPETDIYKAASLLLEAKLERCPVVKSSIEQNLVGI
FT                   VSNTDLLGKMVNRDLSKPVREIMTSPPTTCKPTDNIGEIWSAMLENDYTGLPVVSKKGK
FT                   LMGMITRRDLIKSGFARIGVREKDGSTHNQPVEKVMSTPAYSIKQDTSVKECTEKVLHY
FT                   DVGRLTVDVEDKPVGIVDRSDLLRAYTE"
     atgtcagggg acgcagtgta tctgcacgaa agtgacactg tgacccatgc tcgccagttg        60
     atgagagatc attttctaag gggaattcct gttgtgaacg acaatgggaa ggtttcggga       120
     atgatcactg ataaggatat tttgaaagtg gcatccacaa aatcaaatgt cactgttgcc       180
     ggttttgtaa actcggtccc acagataaca cccgagactg atatttacaa ggccgcttcc       240
     ttgctactgg aagcaaaact tgaaagatgt cctgtagtta aaagttccat tgaacaaaac       300
     ctggtaggaa ttgtaagcaa taccgatctt cttggcaaaa tggtgaatag ggatttatca       360
     aaacctgtca gggagatcat gacctctccg cccaccacat gcaaaccaac agataacatc       420
     ggggaaatct ggtctgccat gcttgaaaat gattatacag gcctgccggt ggtctcaaag       480
     aaaggtaaac tgatgggcat gattaccagg agagacctga taaaatcagg gtttgcacgt       540
     atcggtgtaa gggaaaaaga cggcagcact cacaaccagc cagttgagaa agtaatgtca       600
     acccctgcct acagcatcaa acaggataca tccgtgaaag aatgtaccga aaaggtcctg       660
     cattatgatg tcggcagatt aacagtggat gtggaagaca aacccgtagg cattgtggac       720
     agaagtgacc tgctcagggc ctataccgaa taa                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page