(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE172

CP001994.PE172       Location/Qualifiers
FT   CDS_pept        complement(204998..205288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0175"
FT                   /product="protein of unknown function DUF427"
FT                   /note="COGs: COG2343 conserved hypothetical protein;
FT                   InterPro IPR007361; KEGG: noc:Noc_0837 hypothetical
FT                   protein; PFAM: protein of unknown function DUF427; SPTR:
FT                   Q12TU5 Putative uncharacterized protein; PFAM: Domain of
FT                   unknown function (DUF427)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35710"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="InterPro:IPR038694"
FT                   /db_xref="UniProtKB/TrEMBL:D5E959"
FT                   /protein_id="ADE35710.1"
FT                   /translation="MPVAKYKGVVLADSKVTEKVEGNHYFPPESVNMEYFRDSDTVTVC
FT                   PWKGKGSYYDIVLEDSTLKDGAWYYPQPKPAASNIKGYLAFDTRGGVEITD"
     atgccagttg caaaatacaa aggagtcgta cttgcagata gtaaagttac cgagaaagta        60
     gaaggaaacc attatttccc gccggaatcg gtcaatatgg aatatttcag agacagcgat       120
     acagtaactg tctgcccctg gaaaggcaag ggcagttatt atgatatcgt gctcgaagat       180
     agcacactga aggacggtgc gtggtattac ccgcaaccaa aacctgcagc atcaaacatt       240
     aaaggatatc tggcatttga tacacggggt ggagtggaaa tcaccgactg a                291
//

If you have problems or comments...

PBIL Back to PBIL home page