(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE173

CP001994.PE173       Location/Qualifiers
FT   CDS_pept        205366..206187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0176"
FT                   /product="protein of unknown function Met10"
FT                   /note="COGs: COG2520 methyltransferase; InterPro IPR003402;
FT                   KEGG: dps:DP0629 hypothetical protein; PFAM: protein of
FT                   unknown function Met10; SPTR: Q0W4W1 Putative
FT                   uncharacterized protein; PFAM: Met-10+ like-protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35711"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="UniProtKB/TrEMBL:D5E960"
FT                   /protein_id="ADE35711.1"
FT                   /translation="MSKNSLKTLVEKEVPADLIEYIPNRFDVVGDIAIVSIPPELWDYS
FT                   EMIATKVVSMRGNIGTVLNKISRVKGDHRVSDFKILLGGSTVTTHGEFKYRYRLDLSEV
FT                   FFNPRLGYERHRVTSLVLPREDVLVAFCGVGPFAIPAAIRDVRVFCVEKNRYACHWLAE
FT                   NIRLNNFKGHIYPINADARDIPVILDMKFDRLIVPTPYGQDHFFSLLSPLLKEGGMMHF
FT                   YTFQVAEDIAKSKQAFKDAGYEIIGVRRCGNVARGVSRWVFDLKKNRPAKR"
     atgagtaaaa acagtctcaa aactctcgtg gaaaaggaag ttcctgcaga cttgattgaa        60
     tatatcccta atcgatttga tgtggtcggt gacattgcaa ttgtcagtat tcctcctgaa       120
     ctgtgggact attctgaaat gattgcaaca aaagttgtgt ctatgagagg taatatcggg       180
     acagttctta acaaaataag tcgagtaaaa ggcgatcatc gtgtttcaga ttttaaaatt       240
     ttgctgggtg gcagtactgt aactacacac ggggaattca aatatcgcta tcgtttggac       300
     ctttcggaag tattttttaa tccccggctg ggttatgaga ggcacagggt aacatccctg       360
     gttcttcccc gggaagatgt tttggttgcc ttttgtgggg tgggcccgtt tgcaatccct       420
     gctgctataa gggatgtacg tgttttctgt gtcgaaaaga accggtatgc atgccactgg       480
     ctggctgaga atatacggtt gaataacttt aagggacata tctatcctat aaatgcggat       540
     gcccgggata ttccggtaat tcttgacatg aagtttgaca gactcatagt tcctactcct       600
     tatgggcagg atcatttctt ttctttactc tcccctcttt tgaaagaagg aggtatgatg       660
     catttctata cttttcaggt agctgaggat atagcaaaat caaaacaagc ctttaaggat       720
     gcaggttacg aaataattgg tgtgcgaaga tgcggcaatg tagcacgtgg tgtcagcaga       780
     tgggtgtttg acctgaaaaa gaaccgacca gcaaaaaggt aa                          822
//

If you have problems or comments...

PBIL Back to PBIL home page