(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE176

CP001994.PE176       Location/Qualifiers
FT   CDS_pept        208963..209145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0179"
FT                   /product="protein translocase subunit secE/sec61 gamma"
FT                   /note="COGs: COG2443 Preprotein translocase subunit Sss1;
FT                   InterPro IPR008158; SPTR: Q12UQ2 Preprotein translocase
FT                   subunit secE; TIGRFAM: protein translocase SEC61 complex,
FT                   gamma subunit; TIGRFAM: protein translocase SEC61 complex
FT                   gamma subunit, archaeal and eukaryotic"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35714"
FT                   /db_xref="GOA:D5E963"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR008158"
FT                   /db_xref="InterPro:IPR023391"
FT                   /db_xref="UniProtKB/TrEMBL:D5E963"
FT                   /protein_id="ADE35714.1"
FT                   /translation="MNNRSVSQILKSYYRVLKLARKPARDEFLMISKVAGAGIIVIGIV
FT                   GFVVYILLTELPTWV"
     atgaacaatc gcagtgtcag ccagatcctg aagtcctatt acagggtgct gaaacttgcc        60
     agaaagcctg cacgggacga gttcctcatg atctcaaaag ttgcaggtgc agggattata       120
     gtaatcggca ttgttggctt tgtggtctat attttgctga ccgaattgcc gacatgggtg       180
     taa                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page