(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE182

CP001994.PE182       Location/Qualifiers
FT   CDS_pept        212381..213355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0185"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG0535 Fe-S oxidoreductase; InterPro
FT                   IPR007197:IPR000385; KEGG: scl:sce6686 hypothetical
FT                   protein; PFAM: Radical SAM domain protein; SPTR: Q12UP4
FT                   Fe-S protein, radical SAM family; PFAM: Radical SAM
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35720"
FT                   /db_xref="GOA:D5E969"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5E969"
FT                   /protein_id="ADE35720.1"
FT                   /translation="MSSFSIVSTLRAIWQMKMRRRPYVLSHGVNSRCNMQCPFCEYWKE
FT                   EKPDMTFEEIAQMLDGAADFGIGVYNAWTTEPLLREDLPDILEHAHSKGIITSLVTNGM
FT                   LLEKRLPALSNLDFLSISVDGLESYREIRGIDISHILPGIKKSVEIMERPVLLNCVISS
FT                   KNVDELTDLVYFASEIGARISFEPLYEFENIKDDVWGNMEVKDRAAYRRALDSLIGMKS
FT                   QGYPIINSLTYLKMVRDRKPSFKCHAPDIILNVGCDGMVETCRVHRQPLADIRQGVENA
FT                   WKTSKATMAKTVNECDKCLFFGYAENSLLYDYNLETLRHYEWM"
     atgtccagtt tctcaattgt atctactctg cgtgctatat ggcaaatgaa aatgcgtagg        60
     cgtccctatg ttctgtcaca cggtgtaaat tcccgttgca atatgcaatg tcctttctgt       120
     gaatactgga aagaagaaaa accggatatg acatttgaag agattgctca aatgcttgac       180
     ggggctgcag attttggtat aggtgtttac aatgcctgga caacggaacc tctgcttcga       240
     gaagaccttc cagatattct ggaacatgct cattcaaaag gcataataac ttccctggta       300
     accaatggta tgcttctgga aaaacgcttg cctgctcttt caaaccttga tttcctttcg       360
     atttcagtag acgggctgga aagttacagg gagataaggg gtatcgatat ttcccatatt       420
     cttcccggta tcaagaaaag tgttgagatt atggaacgtc ctgtcctgtt gaattgtgtt       480
     ataagttcta agaacgtgga tgaactgacc gatcttgtgt actttgcatc agagataggt       540
     gctaggattt cttttgaacc tctgtatgaa tttgaaaata ttaaggatga tgtgtggggt       600
     aacatggagg tcaaagaccg tgcagcatat cgcagagctc tggattcact gatagggatg       660
     aaatcacagg gttatccaat tattaattcc cttacctatc tcaaaatggt acgtgacaga       720
     aaaccgtctt tcaaatgcca tgctcctgat attatcctga atgtgggttg tgatggcatg       780
     gtggaaacat gccgggttca tcgccagcct cttgctgata tcagacaggg tgtggaaaat       840
     gcctggaaga caagtaaagc aaccatggca aaaaccgtga atgaatgtga taaatgcctt       900
     ttcttcggtt atgctgaaaa cagcttactg tatgattaca acctggagac gttgcgtcat       960
     tacgaatgga tgtga                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page