(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE184

CP001994.PE184       Location/Qualifiers
FT   CDS_pept        214260..216176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0187"
FT                   /product="Na+/solute symporter"
FT                   /note="COGs: COG0591 Na+/proline symporter; InterPro
FT                   IPR001734:IPR018212; KEGG: dat:HRM2_15670 sodium/solute
FT                   symporter family protein; PFAM: Na+/solute symporter; SPTR:
FT                   Q12UP3 Na+/solute symporter; PFAM: Sodium:solute symporter
FT                   family; TIGRFAM: SSS sodium solute transporter superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35722"
FT                   /db_xref="GOA:D5E971"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D5E971"
FT                   /protein_id="ADE35722.1"
FT                   /translation="MESSQLFLILLAVYLVGLIGIGWYFTKKQNTVTDFWLAGRRIGTV
FT                   GVGFSSAASWLTAGGLLAVIAFFMLQGMGSIWGFVAPNILALLIIAIFVKKIKNLPAIT
FT                   QAELLEQRYSSAIRAPIGIIITIVMILFAVADIKGFALVLETFYGFDPLYAALIVALAV
FT                   SVYVTLGGLSAVVWTDVVQFLFLSVFTIVIAIVSVGAATGGAVDAPANAGELFSNVSSG
FT                   WWNPLSIGIPMVLIFLFAIVPGWITEQDPWQKVWAARDSKSARNGLLLGSLLITIVFAG
FT                   CAVIAIALSSIYPEIPAAGFPMGMAQAEPALLVFVLENFSPFIVALSAIGLAAAAMSCT
FT                   DTFATSGASCVSRDIYQRFIKPDATMKQMLAVNRLSVLFIVLAATVGSFFITSILEAIH
FT                   IATYIASASYFFPLMGGLYWKRATKEGAMAGLIVGAVVQISLIVYDIYMTAPMAPAYLQ
FT                   TVHPVLMNHGVIAGMGLSAVAFFGVSLLTKPSSAVNLAPFFKEEAKNLAAEAAVTVEED
FT                   DPKFQKFLKRIDEQLVGERAHLHVRLESSASVNWHRFVEALRSSYAAWVTPTGVDSVYR
FT                   LVQADMLSCVSITRGTTDKEIWFASEPPASEMGDQKKELFVAYNEVAAALESMGVILTV
FT                   VEE"
     atggaaagtt ctcaattatt cttgatttta ttggcagtct acttagttgg actgattggt        60
     ataggctggt atttcaccaa aaaacaaaac acagtaaccg atttctggct tgccggcaga       120
     cgtatcggga cggtcggggt aggattctcc tcagcagcgt cctggttgac cgcaggaggt       180
     ctgcttgcag tcattgcatt ctttatgctg cagggaatgg gttcgatctg gggctttgtg       240
     gctcccaata ttcttgctct tctgataatt gctatctttg taaagaagat taagaatctg       300
     cccgcaataa cccaggcaga attacttgaa caacgttaca gttcagccat cagggcgccg       360
     attggtatca taataaccat cgtcatgatc ctttttgcag tggctgatat caaaggtttt       420
     gctctggtgc ttgagacatt ctatgggttt gatccattgt atgcagccct gattgttgca       480
     ctggcagttt ctgtttatgt gactttagga ggtctcagtg cggttgtctg gactgatgtg       540
     gtgcagttcc ttttcctctc agtattcacg atagtcatcg caattgtttc tgtaggagca       600
     gctacaggtg gtgctgtcga tgctcctgcc aacgcaggcg agctattttc caatgtttct       660
     tctggctggt ggaaccctct gtccattgga attccgatgg tattgatatt tttatttgca       720
     atagttcccg gctggatcac cgagcaggac ccctggcaga aagtatgggc agcacgtgat       780
     tctaaatccg cacgtaatgg gctgcttctg ggttccctcc tgataacaat tgtatttgca       840
     ggttgtgcgg taattgccat cgctctgagc tccatttacc cggaaatacc ggctgcaggt       900
     ttccctatgg gaatggccca ggcagaaccg gcattgcttg tttttgtgct tgaaaacttt       960
     tccccattca ttgttgccct gagtgcgata ggcctggctg ctgctgctat gtcatgcacg      1020
     gatacctttg caacttccgg tgcatcctgt gtgtcccgtg atatctatca acgtttcatt      1080
     aaaccggatg ccaccatgaa acagatgctt gcggtcaaca ggctcagtgt gcttttcata      1140
     gtccttgcag cgacagtggg ctcatttttc attaccagta tccttgaggc tatccatata      1200
     gccacatata ttgccagtgc ttcctatttt ttccccctga tgggaggtct ttactggaag      1260
     cgtgctacca aggaaggtgc catggcaggt cttattgtgg gtgcagttgt ccagatcagc      1320
     cttatcgttt atgatattta catgacagct ccaatggctc ccgcatatct ccagacggtt      1380
     cacccggtcc tgatgaacca cggtgtcatt gctggcatgg gacttagcgc agttgccttt      1440
     ttcggagtgt ccctgctaac aaaaccatcc agtgctgtca accttgctcc tttcttcaag      1500
     gaagaggcaa agaacctggc agctgaagca gcagttacag ttgaggaaga cgatcccaaa      1560
     ttccagaaat tcctcaagag aatcgatgag caacttgtcg gtgaaagagc acatctgcat      1620
     gtgcggctgg aaagttcggc ttctgtgaac tggcacaggt tcgttgaagc cctgcgatct      1680
     tcctatgctg cctgggtaac tcctaccgga gtggattcag tataccgtct tgtgcaggcg      1740
     gatatgctct cctgtgtatc cataacacgt ggtaccaccg ataaggagat ctggtttgcc      1800
     tctgaacctc ctgcatcgga aatgggtgat cagaagaagg aactctttgt agcctataat      1860
     gaagttgctg cagcccttga aagcatgggt gttatcctta cggtagtcga agaatga         1917
//

If you have problems or comments...

PBIL Back to PBIL home page