(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE188

CP001994.PE188       Location/Qualifiers
FT   CDS_pept        complement(219316..219780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0191"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q46DJ9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35726"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D5E975"
FT                   /protein_id="ADE35726.1"
FT                   /translation="MVAYAIIVCTKCRLQCQVTEERGQKTIQCQRCGATLQFRKLRKFH
FT                   RTEILDEAIAARTALQAQIQGSDSKKASQILSDASIDQLHPSPPTQKKPANPSKYIINA
FT                   LENQEKIQIRQLFQMAEEAGFEREKIEKTLENLKNTGEIYTPGKGYLKLA"
     atggtagcct atgctataat tgtctgcacc aaatgccgct tgcaatgcca ggttacagaa        60
     gagcggggcc aaaagaccat acaatgtcag agatgtggtg caactttaca gtttcgtaaa       120
     ttgaggaaat tccacaggac agaaatactc gatgaagcaa tagcagcgcg aaccgctctt       180
     caggcacaga tacagggatc cgattcaaaa aaagccagcc agattctatc agatgcaagc       240
     atagatcagc tacatccaag cccgcctact caaaaaaaac ctgcaaatcc ttccaaatat       300
     atcataaatg ctcttgaaaa ccaggaaaaa attcagatca gacaattatt ccaaatggct       360
     gaagaggcag gttttgagag agaaaaaatc gaaaaaaccc ttgaaaacct gaaaaatacg       420
     ggagaaatct acactcccgg taaaggctat ctgaaacttg cctga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page