(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE19

CP001994.PE19        Location/Qualifiers
FT   CDS_pept        complement(18487..19899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0019"
FT                   /product="histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterPro IPR004358:IPR003594:IPR005467; KEGG:
FT                   afw:Anae109_3161 PAS/PAC sensor signal transduction
FT                   histidine kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   SPTR: Q12XC6 ATP-binding region, ATPase-like protein; PFAM:
FT                   Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35557"
FT                   /db_xref="GOA:D5E8P8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8P8"
FT                   /protein_id="ADE35557.1"
FT                   /translation="MESKPPIILLSNDLYYHGTGLTSNKERLKDASILNIQDFENRDPE
FT                   SQQEVLESHGTLYIITSANEGSLPQVLNTCDNEIYRIKAEECRDTEKYACPYILNAKLM
FT                   ELLLEQREAEIRKLNEQMSSYLIAMDSIYTLSSYDRKEDIINHTKEFFAMMCLPENLCY
FT                   FEAHNTKAQSGIHLTDFQKKDIVAFLKSNKYYKIAPSEKSFCFRLTLQDGDEGIFVLEN
FT                   IAYQSRLHEFLNLTLSIRSVLTVVLENISKQNELEKSHNLLADANDMLKVINKILRHDL
FT                   ANNLGAIKMSLEMNETRPNPKYIQISKKAVDRSFQKINDMKGLENLIGTGKDLDCYEVK
FT                   EIIEKTAGTDIEMDISIEGQCKVLADNALSSVFENIIKNAIAHGKANKMRIKMEPSGKY
FT                   CHISIVDNGTGIPDEIKPKIFKEGFTEGGDSNSGLGLYISKKVIERYGGQIEVKDNTPH
FT                   GAKFVLDIPSTK"
     atggaatcta aaccccctat aatattgctt tcaaatgacc tctattacca tggtacagga        60
     ctcacttcca ataaagagag attaaaggac gcatccatac tcaatataca ggattttgaa       120
     aatcgggacc ctgaatcaca gcaagaggtg ctagaaagcc atggtactct gtatataatc       180
     acatctgcca atgaaggatc tttacctcag gtgctgaaca catgtgataa tgaaatatat       240
     cgcataaagg ctgaagaatg tcgggacacc gaaaaatacg cttgtccgta tatccttaat       300
     gcaaagctta tggaattact acttgagcaa agggaagcag aaattcgcaa gctcaacgag       360
     caaatgtcct cttacttgat agcaatggat tcaatttata ctctctcctc atatgatcgc       420
     aaggaggaca ttataaatca tacaaaagaa ttctttgcaa tgatgtgcct gcccgaaaac       480
     ctgtgttatt ttgaggcaca taacacaaag gcacaaagtg gcatacatct tactgatttc       540
     cagaaaaagg atattgtagc ttttcttaag agcaataaat attacaaaat agccccttcg       600
     gaaaagagtt tctgtttcag gttaacttta caggacgggg atgaagggat atttgttctg       660
     gaaaatatag cctatcagag tcgtttacat gaattcttga atttaacttt gagcattcgc       720
     agcgtactta cagtggtact ggagaatatt tccaagcaga atgaactgga aaagtcacat       780
     aatttacttg ccgatgcaaa cgatatgctg aaagtaatta acaagatttt gcggcatgac       840
     ctggctaata atctgggtgc cataaaaatg tccctggaga tgaatgaaac caggcccaat       900
     ccaaaatata tccaaatctc caaaaaagct gttgaccgca gttttcaaaa aatcaatgat       960
     atgaaagggc ttgaaaacct catcggtacc ggaaaagacc ttgactgtta tgaagtgaag      1020
     gaaattatag aaaaaactgc aggtacagat attgaaatgg atatttccat tgagggccaa      1080
     tgcaaggttc tggcggataa tgcattatcc tctgtttttg aaaatataat aaaaaatgca      1140
     attgctcatg gtaaagccaa taaaatgagg attaaaatgg aaccttccgg caagtattgt      1200
     cacatttcta tagtggataa cggcacaggg atccccgatg aaataaagcc aaaaatcttc      1260
     aaggaaggat ttaccgaagg cggagatagc aattctggat tgggtctgta tatctcaaaa      1320
     aaggttatag aaagatatgg aggccaaatt gaagtaaagg acaatacacc acatggagca      1380
     aaattcgtcc tcgatatacc ctctacaaag tga                                   1413
//

If you have problems or comments...

PBIL Back to PBIL home page