(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE192

CP001994.PE192       Location/Qualifiers
FT   CDS_pept        224596..224946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0196"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q8TQY1 Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35730"
FT                   /db_xref="UniProtKB/TrEMBL:D5E979"
FT                   /protein_id="ADE35730.1"
FT                   /translation="MAKKWMLVLLLVLTVSFAGCVNKDSLVERTNDSLLEESKDIAEAY
FT                   VLNHEDYMRYSVTEPVFLGSEKLDCSNCWSFTYEFDLISAKDPDVIDTATINVTVKDLE
FT                   VVETVYSQGMKD"
     atggccaaaa aatggatgtt ggttttgtta ttagtcctca ctgtatcgtt tgcaggttgt        60
     gtaaacaaag attctcttgt ggaaagaaca aatgatagtc tgctggagga aagtaaggat       120
     attgcagagg cctatgttct caaccatgag gattatatgc gatatagtgt tacagaaccg       180
     gtttttctgg gttctgaaaa actggattgt tcaaactgct ggtcgttcac ctatgagttc       240
     gatctgatct ctgcaaagga tcccgatgtt attgatactg caacgatcaa tgtgacagtt       300
     aaggatctcg aggttgttga aacagtgtat tcacagggta tgaaggactg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page