(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE194

CP001994.PE194       Location/Qualifiers
FT   CDS_pept        226824..228443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0198"
FT                   /product="thermosome subunit"
FT                   /note="COGs: COG0459 Chaperonin GroEL (HSP60 family);
FT                   InterProIPR017998:IPR001844:IPR002423:IPR002194:IPR 012714;
FT                   KEGG: similar to Chaperonin containing TCP1, subunit 4
FT                   (delta); K09496 T-complex protein 1 subunit delta; PFAM:
FT                   chaperonin Cpn60/TCP-1; SPTR: Q46DJ0 Hsp60; TIGRFAM:
FT                   thermosome; PFAM: TCP-1/cpn60 chaperonin family; TIGRFAM:
FT                   thermosome, various subunits, archaeal"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35732"
FT                   /db_xref="GOA:D5E981"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012714"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:D5E981"
FT                   /protein_id="ADE35732.1"
FT                   /translation="MAGQPIYILADGSQVTRGRDAQSNNIMAGKAVANAVRTTLGPKGM
FT                   DKMLVDSMGDVVITNDGATILKEMDIEHPTAKMIVEVAKTQDDEVGDGTTTAAVLAGEF
FT                   LSKAEELLKKGVHPTIIATGYRQAAKKAVEIVKSISIDISRDDTEALKKVANTAITGKG
FT                   AESHKEMLAELTVEAVSLIGEETDDGYVADVSDIKIEKQAGESVGESKLVKGLVLDKAR
FT                   THPNMPEKIEDAKILVLSVPVEFKKTEMDAEIKISSPDQMQMFLDQEEKMVKQMTDKIL
FT                   NSGANVVFCQKGIDDLAQYYLEKAGIYAAKRLKKSDLDRICEATGATNIQDIDEITAKD
FT                   LGSADLVEERDIKGNKMTYITGCREKKAVSIILHGGTQHVVDSLQHAVDDALHVVAVAL
FT                   EDGKVVAGGGSPEVELSMRLGEYASSLSGREQLAVAKFAEAFEVIPETLAENSGYDPIN
FT                   KLVELRSKHEEGNKRMGLNVYTGEIVDMWESNVIEPLRAKTQAINAGTEAAVMVLRIDD
FT                   VVAASPHSNQASPEMPDMDMDM"
     ttggcaggac agccgatata cattttagca gacggaagtc aggtaacaag gggcagggat        60
     gcccagagca ataacattat ggcaggcaag gcagttgcca acgcagtccg tactaccctt       120
     ggtcccaagg gcatggacaa gatgctagtg gattcaatgg gtgatgtggt aatcaccaat       180
     gacggtgcaa ccattctcaa ggaaatggac attgaacacc ccacagccaa aatgatcgtt       240
     gaggtggcca agacccagga tgatgaagtc ggagacggta cgaccacagc agccgtactg       300
     gccggtgaat tcctttccaa ggcagaggaa cttctcaaga aaggtgtaca ccccacaatt       360
     attgcaacag gttacaggca ggctgccaaa aaggcggttg aaatcgtaaa aagtataagt       420
     atagatattt cccgtgacga tactgaagcc ctcaaaaaag tggcaaacac cgcaattacc       480
     ggaaaaggtg cagaatctca caaggaaatg cttgcagagc ttaccgttga agctgtatct       540
     ctcataggag aagaaacgga tgatggctat gttgcagatg taagtgacat caaaatagaa       600
     aaacaggctg gtgaaagtgt tggtgagtcc aaacttgtaa aaggccttgt tctggataaa       660
     gcccgcacac atcccaacat gcccgaaaag atcgaggatg caaaaatcct tgtcctcagt       720
     gtcccggttg aattcaaaaa gaccgagatg gatgccgaga taaaaatatc ttccccggac       780
     cagatgcaga tgtttttgga tcaggaagaa aagatggtca aacagatgac cgacaagatt       840
     ctgaattccg gtgcaaatgt tgtcttctgc cagaagggaa tcgatgatct tgcacaatat       900
     tacctcgaaa aggctggcat ctatgcggcc aagaggctta aaaagagcga tctggatcgt       960
     atctgtgaag ctaccggtgc aacaaatatt caggatatcg atgaaatcac tgccaaggac      1020
     ctgggttctg cagatcttgt ggaagaacgt gatataaaag gcaacaagat gacctatatc      1080
     acaggatgca gggaaaagaa agctgtttca ataatccttc acggtggtac ccagcacgtt      1140
     gtagattctc tccagcatgc cgtggacgat gctcttcacg tagtcgctgt ggctctggaa      1200
     gacggcaaag tagtcgcagg cggcggatct cctgaagtag aactctccat gcgtcttggt      1260
     gaatatgcat cctccctcag tggcagggaa cagcttgcag ttgccaaatt cgcagaagca      1320
     tttgaagtaa ttcccgagac acttgccgaa aactcaggtt atgacccaat aaacaaactt      1380
     gttgaactgc gttccaaaca tgaagaaggc aacaagagaa tggggcttaa tgtatacacc      1440
     ggtgagattg ttgacatgtg ggagagcaat gtaatcgaac cattacgtgc caagacacag      1500
     gcaattaacg ccggaacaga agcagctgtc atggttctta gaattgatga cgttgttgcg      1560
     gcatcccctc actccaacca ggcatccccc gaaatgcctg atatggacat ggatatgtaa      1620
//

If you have problems or comments...

PBIL Back to PBIL home page