(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE196

CP001994.PE196       Location/Qualifiers
FT   CDS_pept        229077..229901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0200"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1122 ABC-type cobalt transport system
FT                   ATPase component; InterPro IPR003439:IPR003593:IPR017871;
FT                   KEGG: sat:SYN_00209 ABC-type cobalt transport system,
FT                   ATPase component; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase; SPTR: Q8TI16 Cobalt import ATP-binding protein
FT                   cbiO; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35734"
FT                   /db_xref="GOA:D5E983"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E983"
FT                   /protein_id="ADE35734.1"
FT                   /translation="MIEIENLSFGFKENQRVLDGINVSIDSGEFVVLVGGNGSGKSTFV
FT                   RHLNGLLLPDEGMVKVWGMDTCVISNLTAIRRKVGMVFQNPLTQFIGATVEEDVAFGLE
FT                   NLAYPSSIIREKTDHSLAELGISHLAGKSPLELSGGQMQLAALAGVLVMEPECVIFDEV
FT                   TSMLDFFSKQQVLATITRLHEKGKTIIMVTHNLEEVHLAERVIAFEKGSIVYDGNSSLF
FT                   FDSPAVSNPGISIPPLTELALWLRNNGLKEIDVSNPDANALEESIWQSISRI"
     atgattgaga ttgaaaattt aagttttggt ttcaaggaaa atcaacgtgt ccttgacggc        60
     atcaatgtgt cgattgacag tggtgaattc gttgtcttgg taggtggtaa tggtagtggt       120
     aagtccacct ttgtcaggca tctgaatggt ttactactgc cggatgaagg tatggtgaaa       180
     gtgtggggta tggatacatg cgttatctcc aatctaactg ctatacgcag gaaagttggt       240
     atggttttcc agaaccccct aacccagttc ataggtgcca ctgtagagga agatgtggct       300
     tttggtcttg aaaacctggc ctacccatca tcaataatcc gtgaaaaaac ggatcactct       360
     cttgcagagc tggggatatc acatctagcg ggcaaatctc ctttggaact gagtggcgga       420
     cagatgcaac ttgcagccct tgcaggtgtc cttgtcatgg agcctgaatg tgtgatattt       480
     gacgaggtaa cctccatgct ggatttcttc tcaaaacaac aggtgcttgc aaccatcacc       540
     aggcttcatg aaaagggcaa gacgataata atggtcaccc acaacctgga ggaggtccat       600
     cttgctgaaa gggttatagc ttttgaaaaa gggagcattg tctatgatgg caattcttct       660
     ttgttttttg attctcctgc tgtttcaaat cccggtattt caattcctcc tcttactgaa       720
     cttgcccttt ggctacggaa caacggtctc aaagagatcg atgtttcaaa ccctgatgct       780
     aatgcactgg aggaatctat ctggcaatcg atatcaagaa tttga                       825
//

If you have problems or comments...

PBIL Back to PBIL home page