(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE199

CP001994.PE199       Location/Qualifiers
FT   CDS_pept        231728..233659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0203"
FT                   /product="Hydantoinase/oxoprolinase"
FT                   /note="COGs: COG0145 N-methylhydantoinase A/acetone
FT                   carboxylase beta subunit; InterPro IPR008040:IPR002821;
FT                   KEGG: sme:SMc02580 hypothetical protein; PFAM:
FT                   Hydantoinase/oxoprolinase; Hydantoinaseoxoprolinase domain
FT                   protein; SPTR: Q12UM9 Hydantoinase/oxoprolinase; PFAM:
FT                   Hydantoinase/oxoprolinase; Hydantoinase/oxoprolinase
FT                   N-terminal region"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35737"
FT                   /db_xref="GOA:D5E986"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:D5E986"
FT                   /protein_id="ADE35737.1"
FT                   /translation="MVYSLGIDAGGTYTDSVLLDDDTDSILDSNKALTTYPDPLDGIKN
FT                   SIDGLDQEKLKKVKIVSVSTTLSTNTILEGTGFPVGLFLIGNYDLKEKLPTPHYVKVAG
FT                   GHTYNGGEKEPLDEEAVRDFAVKIKDKVAAFAISSFFSIRNPDHEIRAKQIIREATGLP
FT                   VVCAHELSQDLGAFERATTAFFNAQLLPITERFMSTVEKDVTSRGISPKIFMLKCDGSV
FT                   IGIKSALEKPIESIFSGPAGSLVGASFLTGNDSCAVIDVGGTSTDISVIKDGVPEMSEM
FT                   GAVVGGWKTRVKAIKMETSAMGGDSHIWVKDGKLNVGPRRVIPLCRAADLYPHFLELLK
FT                   INPIPSKTLIGMNFQPTTFFTRTEYEAMGLNDLEQELLDSISSSPTSLRELRSRMGRYP
FT                   STRILDSLIQKRLVQCIGFTPTDALHVLGDYTARNVEAAEVGAEYLGSLCKRTGDEFAR
FT                   YVKETFAKNMASDLISFFLEGIPREEIRKIFDIDCPTKFKVDIPVVLIGGPVVAYKDIL
FT                   GSIIDAEIIVPKYSDVGNATGALAAKGVRRVDFLIRPASMAAPDWEYYVFSEKGRQSFY
FT                   EYKDAIKYARETGQSMVMQYMEDAGLDPDHVEIDVKKDEIVPEGWDFPMETRIRIIGVG
FT                   TRLIDEEA"
     atggtataca gtttgggaat agatgctgga ggaacttata ctgattctgt tcttctggat        60
     gatgacactg atagtattct tgattcaaat aaagcactta caacatatcc cgatcccctt       120
     gatgggataa aaaactcaat tgatggtcta gatcaggaaa aactcaagaa agtaaagatt       180
     gtttccgtat caacaaccct ttctacaaac acgattcttg aaggtacggg tttccccgtt       240
     ggcctgttct tgataggaaa ttatgatctc aaggaaaaac ttccgactcc ccattacgta       300
     aaagttgccg gtggccatac atataatggt ggggagaaag agcctctgga tgaagaagca       360
     gtcagggatt ttgcggtgaa aataaaggac aaggttgcag cttttgcaat ttcttccttc       420
     ttcagtattc gtaaccccga tcatgagatc cgggccaagc aaataatccg cgaagctacc       480
     ggtcttcctg tggtatgtgc acacgaactt tctcaggatc tgggtgcctt tgagagagca       540
     actactgcct ttttcaatgc tcagctattg cccattacag aaagattcat gtccactgtg       600
     gaaaaggatg taacttccag gggaatcagc ccgaagatat tcatgctcaa atgtgacggt       660
     tctgtaattg gtatcaagag tgcactggaa aagccgattg aatctatttt ctcaggacct       720
     gcgggaagcc ttgtaggtgc ttcctttttg acaggaaatg actcatgcgc cgttattgac       780
     gtgggaggta caagtaccga tatttccgtt ataaaagacg gtgtccctga aatgagtgag       840
     atgggagcgg ttgtcggagg atggaagacc cgtgtcaaag ccattaagat ggaaacctca       900
     gcaatgggtg gtgacagtca catatgggta aaggacggta aattgaatgt cggaccgcga       960
     cgtgtgattc ctctttgcag agcagctgat ctctatcccc atttcctgga acttctcaag      1020
     atcaatccca taccatccaa aactttgatc ggcatgaatt tccagcccac gactttcttt      1080
     acacgtactg aatatgaagc catgggcctt aatgacctgg agcaggaatt gcttgattcc      1140
     atttcaagca gtcccacctc gctgagggag ctacgcagcc gcatgggcag gtatccctca      1200
     accaggattc tggatagcct tattcagaaa aggcttgtgc agtgtattgg ttttacaccc      1260
     acggatgctc tgcatgtact gggagattac actgcccgca atgtggaagc agctgaggtg      1320
     ggtgctgaat acctgggctc cctgtgtaaa agaaccgggg atgaatttgc caggtatgtc      1380
     aaggaaacct ttgccaagaa catggcctcc gacctgattt cctttttcct ggaaggcatt      1440
     cccagggaag agattcgtaa aatattcgat atagattgtc ctacaaagtt taaggttgat      1500
     atcccggttg ttcttatcgg tggacccgtg gttgcttata aggatatact tggaagtatt      1560
     attgatgccg agattattgt gccaaaatat tcggatgtcg gtaatgccac aggtgccctt      1620
     gcagccaaag gtgtaagaag ggttgatttc cttataaggc ctgcttccat ggcagcgccg      1680
     gattgggaat actacgtatt ttctgaaaaa gggcgacaga gtttctatga atataaagat      1740
     gctataaaat atgccaggga aacaggacaa tccatggtca tgcaatacat ggaagacgcc      1800
     ggtttggatc cggatcatgt ggaaattgac gtcaagaagg atgagattgt gccggaaggt      1860
     tgggatttcc caatggaaac cagaatcagg ataataggag tcggcacccg cctgatagat      1920
     gaagaggcct ga                                                          1932
//

If you have problems or comments...

PBIL Back to PBIL home page