(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE218

CP001994.PE218       Location/Qualifiers
FT   CDS_pept        250956..252140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0223"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.1"
FT                   /note="COGs: COG3635 phosphoglycerate mutase AP
FT                   superfamily; InterPro
FT                   IPR019304:IPR006124:IPR004456:IPR013371; KEGG:
FT                   pca:Pcar_1514 cofactor-independent phosphoglycerate mutase;
FT                   PFAM: 2,3-bisphosphoglycerate-independent phosphoglycerate
FT                   mutase; metalloenzyme domain protein; PRIAM:
FT                   Phosphoglycerate mutase; SPTR: Q12UL5
FT                   2,3-bisphosphoglycerate-independent phosphoglycerate
FT                   mutase; TIGRFAM: proposed homoserine kinase;
FT                   phosphonopyruvate decarboxylase-related protein; PFAM:
FT                   Metalloenzyme superfamily;
FT                   2,3-bisphosphoglycerate-independent phosphoglycerate
FT                   mutase; TIGRFAM: 2,3-bisphosphoglycerate-independent
FT                   phosphoglycerate mutase, archaeal form; proposed homoserine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35756"
FT                   /db_xref="GOA:D5E9A5"
FT                   /db_xref="InterPro:IPR004456"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR023665"
FT                   /db_xref="InterPro:IPR042253"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9A5"
FT                   /protein_id="ADE35756.1"
FT                   /translation="MKHIVLIGDGMADYPIKELGDKTVLEAADTPHMDRMALEGINGLA
FT                   TNVPDGMPAGSDVANMSVLGYDPAKHYSGRAPLEAASMGIELDKNDVAFRCNLITIENG
FT                   DILDHSAGHISTEEASQLMQAIEDELGGDVHFYPGISYRHLMVAQFGADAVCTPPHDVV
FT                   EEPALDHMPRGDSAEKLQELIRASWNILSEHPVNKKRIEEGKRPANSIWLWGQGYAPSM
FT                   PSFEEMYGLKAAVISAVDLIKGLGICEGMDVIEVPGATGYLDTNYVGKAEYALESLKDH
FT                   DIVFVHVEAPDEAGHMGSLEAKIQAVEDFDSKVVGTILEGIEKLSEECTVLVLPDHPTP
FT                   IAVRTHTPDPVPFVIYPSFNRDADIVKTYSEDAATDGILSTVRGCDLIRTMLSL"
     atgaaacata ttgtattaat tggtgacgga atggcagatt atcctattaa ggaacttgga        60
     gacaaaactg tattagaagc tgcggatact cctcacatgg accgtatggc actggaggga       120
     ataaatggac tggctaccaa tgttccggat gggatgcccg caggtagtga tgtggctaat       180
     atgtccgttc ttggttatga tcctgccaaa cattattcgg gacgtgctcc tttagaagca       240
     gcaagtatgg gtattgagct ggataaaaat gatgttgctt tccgttgtaa cctgataaca       300
     attgaaaatg gcgatatact ggatcacagt gcaggtcata tttccactga agaagcaagt       360
     caattaatgc aggcaattga ggatgaactg ggtggggatg tccattttta tcctgggata       420
     agttatcgcc accttatggt tgcccaattt ggtgcggatg ctgtctgtac acctcctcat       480
     gatgtggttg aggaaccggc tttagatcac atgcctcggg gtgattctgc agaaaaactc       540
     caggaattga tcagggcttc ttggaatatc ctttccgagc atcctgtgaa taaaaaacgc       600
     attgaagaag gaaagagacc tgccaattcc atatggttat ggggtcaggg ttatgctcct       660
     tcgatgcctt cttttgaaga aatgtacgga ttaaaagcag ctgtaatatc tgcagtcgac       720
     cttatcaagg gcctaggtat ctgtgaagga atggatgtaa ttgaagttcc cggtgctacc       780
     ggatatcttg atacaaatta tgtgggtaag gcagaatacg ctcttgaatc cctgaaagat       840
     catgacattg tttttgtcca tgtagaagct ccggatgaag cgggacatat gggtagtctg       900
     gaggccaaga tacaggcagt tgaggacttt gattccaaag tagtgggtac catccttgaa       960
     ggaatagaaa aactgtctga agaatgtact gtacttgtcc ttcccgatca tccgacaccg      1020
     attgcagtaa ggacccatac tcctgatcct gtaccatttg tgatttatcc atctttcaat      1080
     cgggatgccg atattgtcaa aacttactca gaagatgcag ctacagatgg tattctttca      1140
     actgtcaggg gttgcgacct gatacgtacc atgctttccc tttga                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page