(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE219

CP001994.PE219       Location/Qualifiers
FT   CDS_pept        252221..252685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0224"
FT                   /product="heat shock protein Hsp20"
FT                   /note="COGs: COG0071 Molecular chaperone (small heat shock
FT                   protein); InterPro IPR017447:IPR002068:IPR007052; KEGG:
FT                   glo:Glov_2790 heat shock protein HSP20; PFAM: heat shock
FT                   protein Hsp20; CS; SPTR: Q12UL4 Heat shock protein Hsp20;
FT                   PFAM: Hsp20/alpha crystallin family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35757"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9A6"
FT                   /protein_id="ADE35757.1"
FT                   /translation="MKRGLMRRGNSPSVSRWDPFDEIKQTQDYLNDLFREFLPSVQWKG
FT                   GETMSPLVDVQEKDESVVVTTDLPGVNKEDVDIRVSEGMIEISAACKKEEEKEEEGYFQ
FT                   KERRYSSFSRAVSLPASVTEEGATAKLEEGVLTVTLPKTKEAEKPKVPIE"
     atgaaaagag gattaatgcg caggggaaat tcaccttcag taagcagatg ggatccattc        60
     gatgagataa aacagacaca ggattatctt aacgacctgt tcagggaatt cttaccttca       120
     gtacaatgga agggtggtga gacgatgtct ccccttgtag atgtccagga gaaggatgag       180
     tcagtagtgg taaccacaga ccttccgggt gtcaataagg aggatgtgga catccgtgta       240
     tccgagggta tgattgagat cagtgcagca tgtaaaaagg aagaagagaa agaggaagaa       300
     ggttacttcc agaaagagcg caggtattca agtttctcca gagcggtctc tttaccggct       360
     tctgtgactg aggaaggtgc cacagccaaa cttgaggaag gggtgctgac agtcacatta       420
     ccaaaaacca aagaagctga aaagccaaag gtcccaatcg aataa                       465
//

If you have problems or comments...

PBIL Back to PBIL home page