(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE220

CP001994.PE220       Location/Qualifiers
FT   CDS_pept        252874..253629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0225"
FT                   /product="coenzyme F420-0 gamma-glutamyl ligase"
FT                   /EC_number="6.3.2.-"
FT                   /note="COGs: COG1478 conserved hypothetical protein;
FT                   InterPro IPR002847:IPR000292:IPR008225; KEGG: eba:p2A347
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF129; SPTR: Q8PX01 F420-0:gamma-glutamyl ligase; TIGRFAM:
FT                   F420-dependent oxidoreductase; PFAM: F420-0:Gamma-glutamyl
FT                   ligase; TIGRFAM: F420-0:gamma-glutamyl ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35758"
FT                   /db_xref="GOA:D5E9A7"
FT                   /db_xref="InterPro:IPR002847"
FT                   /db_xref="InterPro:IPR008225"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9A7"
FT                   /protein_id="ADE35758.1"
FT                   /translation="MEAFTVDDIPLIKPGDDIAAIICQRVGLEDGDVLVIASTIIAKAE
FT                   NELFSLDNITPSARAIGIGKKDGKDPRLVQAVLDRCSECFVESPVMLVQSDRAHVCINS
FT                   GVDDSNVENDLLADLPRDADASARIIGERVEEITGCRVAVVVTDTNGRAFRLGQTGVAI
FT                   GLYHATPIYYWRGKKDLFGYEMQISEEAVADEVAAAANLLMGEGSGGNPVVVVRGTSLF
FT                   TGGKTSACQLYRPDNMDIIKKALRIFKES"
     atggaagcct ttactgttga tgatatacct ctgataaaac ctggtgacga cattgcggcc        60
     attatatgtc agcgtgtcgg gctggaagat ggcgatgtgc tggttattgc ttctaccata       120
     attgcaaaag ccgagaatga actgttttcc cttgacaata tcacgccctc tgcccgggca       180
     attgggattg gtaaaaagga tggtaaagac ccgcggcttg tacaggctgt actggacaga       240
     tgcagtgagt gttttgtcga atctcctgta atgcttgtac aatccgacag ggcacatgta       300
     tgcatcaatt caggagtgga tgattccaat gtcgagaatg atttacttgc cgatcttccc       360
     cgggacgcgg atgccagtgc cagaatcata ggtgagagag ttgaagagat tacaggttgc       420
     agggttgctg ttgtggtaac tgataccaat ggcagggctt tcagactggg ccagacaggg       480
     gttgcaatag ggctgtacca tgccacaccc atttattact ggagaggtaa aaaggatctt       540
     ttcggctatg aaatgcagat cagtgaagag gcggttgccg atgaagtggc agctgctgca       600
     aacctgctga tgggggaggg tagtggaggt aatccggtag ttgttgtacg gggcacatcc       660
     ctgtttaccg ggggaaagac atctgcctgc cagctgtaca ggccggacaa tatggatatc       720
     atcaagaagg ccttacgcat tttcaaggag tcttga                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page