(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE229

CP001994.PE229       Location/Qualifiers
FT   CDS_pept        261829..263007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0234"
FT                   /product="3-hexulose-6-phosphate synthase"
FT                   /EC_number="4.1.2.43"
FT                   /note="COGs: COG1795 conserved hypothetical protein;
FT                   InterPro IPR014826:IPR000056:IPR001754; KEGG: bxe:Bxe_B2436
FT                   formaldehyde-activating protein; PFAM:
FT                   Formaldehyde-activating enzyme (Fae); ribulose-phosphate
FT                   3-epimerase; Orotidine 5'-phosphate decarboxylase; SPTR:
FT                   Q12UK3 Bifunctional enzyme fae/hps; TIGRFAM:
FT                   formaldehyde-activating enzyme; PFAM: Orotidine
FT                   5'-phosphate decarboxylase / HUMPS family;
FT                   Formaldehyde-activating enzyme (Fae); TIGRFAM:
FT                   formaldehyde-activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35767"
FT                   /db_xref="GOA:D5E9B6"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014826"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020868"
FT                   /db_xref="InterPro:IPR037075"
FT                   /db_xref="InterPro:IPR041710"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9B6"
FT                   /protein_id="ADE35767.1"
FT                   /translation="MMLIGEALIGEEPELAHIDLMIGDKEGPVGQAFATGMTQLSAGHT
FT                   PLLSVIRPNLPTKPSTLIVPKVTVKNMDQASQIFGPAQAAVSKAVADAVEEGIVPKEKA
FT                   DDLVIVASVFIHPQALDYNRIYRYNYGATKLALKRAMENFPAVDTVLDEKDKGSHAVMG
FT                   FKVSRLWDPPYLQVALDNPNLEAVLNVVRQLPKSDHLILEAGTPLIKRYGVDVITKLRE
FT                   VKPDAFIVADLKTLDTGNLEARMVADATADAIVVSALAPIPTLEKAISEAHKTGIYAVM
FT                   DTLNQPDPMAVLKELNELPDVVELHRAIDVEDTAYAWGSIDAIKELSPKILVAVAGGVR
FT                   VHTIPDALKAGADILVVGRAITNSKDIRQSAEQFVEGLNKPEIDQFRVMTDF"
     atgatgttaa ttggagaagc acttataggc gaggaacccg aactcgcaca tattgatctt        60
     atgatcggtg ataaggaagg acctgttggg caggcctttg ctaccggtat gactcagtta       120
     tccgcaggac acactcccct gctttctgtg atcaggccta acctacccac aaaaccttcc       180
     acactcatcg ttcccaaggt gacggtaaag aatatggacc aggcatccca gatatttggt       240
     cctgcacagg cagcggtttc aaaagcggtt gcagatgccg tggaagaagg cattgtaccc       300
     aaagaaaaag ccgatgatct tgtgatcgtg gccagtgtat tcatacaccc tcaggctttg       360
     gattataatc gcatctacag gtataattac ggtgcgacca aacttgcact gaaaagggca       420
     atggagaatt tccctgccgt agatactgta ctggatgaaa aggacaaagg ttcccatgca       480
     gttatgggat tcaaagtttc cagactatgg gaccctccat acctgcaggt agcactggat       540
     aatccaaacc tggaagcagt gctcaatgtt gtaagacagc tgcccaagag tgaccatctt       600
     atccttgaag caggaactcc tctgatcaaa cgttacggtg tggatgtaat caccaaactg       660
     cgtgaagtca aacctgatgc tttcatcgtg gctgacctga agaccctgga taccggtaac       720
     cttgaggcac gtatggttgc agatgccaca gctgatgcaa tcgtggtttc cgcccttgca       780
     ccgataccaa ctcttgaaaa ggcaatctca gaggctcaca agacaggaat ctatgcggta       840
     atggatactc tcaatcagcc tgacccaatg gctgtgctta aggaactcaa tgagcttccg       900
     gatgttgtgg aacttcaccg tgccatagat gtagaggata ctgcatatgc ctggggcagt       960
     attgatgcaa tcaaggaact gtccccgaag atccttgtgg cagttgctgg tggtgtgcgt      1020
     gtgcatacaa tccctgatgc tcttaaggca ggtgcggata ttcttgttgt cggacgtgca      1080
     attaccaatt ccaaggatat acgccagtct gcagaacagt tcgtcgaagg cctgaacaag      1140
     ccagagatag accagttcag ggtaatgact gatttctga                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page