(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE239

CP001994.PE239       Location/Qualifiers
FT   CDS_pept        complement(270396..270725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0244"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q12UI2 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35777"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9C6"
FT                   /protein_id="ADE35777.1"
FT                   /translation="MGREFTDRDMDIFNKLAPEAGGNNISQMGHPYPFILRPISHRFAE
FT                   SGEDFRNRLEKLDRADVEYLADLAIEGKEDVRGLEDEDMDSFFSVLEGFSPEKLEELKD
FT                   KLGMI"
     atgggacgag aatttacaga cagagacatg gatattttca acaaacttgc ccccgaagcc        60
     ggcggaaaca acatttcaca gatgggacat ccctatccct ttattctcag gccgatttcc       120
     catcgttttg ccgaatcagg agaagatttc cgcaatcgtc tggaaaaact ggaccgtgca       180
     gatgtggaat acctggcaga ccttgcaatt gagggaaaag aggatgtcag gggactggaa       240
     gacgaggata tggattcttt tttcagcgtt cttgaaggat tttcacccga aaagctggaa       300
     gaactcaagg acaagttggg gatgatctga                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page