(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE24

CP001994.PE24        Location/Qualifiers
FT   CDS_pept        24183..25502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0024"
FT                   /product="DNA primase"
FT                   /EC_number="2.7.7.-"
FT                   /note="COGs: COG0358 DNA primase; InterPro
FT                   IPR006171:IPR006154; KEGG: spe:Spro_4299 DNA primase; PFAM:
FT                   TOPRIM domain protein; SMART: Toprim sub domain protein;
FT                   SPTR: Q12V67 UPF0095 protein Mbur_1769; PFAM: Toprim
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35562"
FT                   /db_xref="GOA:D5E8Q3"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR020607"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8Q3"
FT                   /protein_id="ADE35562.1"
FT                   /translation="MQSTDTTKYIIHSKINADGVIERPDIVGAIFGQTEGLLGSDLDLR
FT                   DLQKTGRIGRIEVIVSTKGGKTKGNIHIPSSLDRIETSILAASLETIDRVGPCSANIEV
FT                   SNIEDVRATKRKHIVERAKFILTGMFDANLPESQEIADEVRQSVRVEEMQFFGKNKNIP
FT                   CGPNVLDSDAIVVVEGRADVLNLLRYGIKNAICVGGTNVPPEVAELTRKKTVTAFTDGD
FT                   RGGKLIIKELLQVADIDYVARAPDGKTVEDLVQREIIRALRQKVPVEQAMEAYSIDKPA
FT                   EKTTTPSSSGPKKGGRIARVPKREKRVKPDRARNPAAKMKKIAEPPIKKEKPKPSSTKP
FT                   ATSQHPVLKRLSSHSESLAGTLGARLLDQDDKVVNETPVRDLVNTLKNSEDNVKSVVFD
FT                   GVVTQRILDIASNKGIDTLIGVKKGNITKSPANVKVYTSA"
     atgcaaagta ctgatacaac aaaatatatc attcattcaa aaatcaatgc tgacggggtg        60
     atagaacgcc ctgatatagt aggagctatc ttcggacaga ccgaaggttt gctggggtca       120
     gatcttgatc tgcgtgatct ccagaagacc ggcaggatcg gcaggatcga ggtcattgta       180
     agcaccaagg gtggaaagac caagggcaac atacacattc cttccagtct ggacaggatc       240
     gagacatcaa tcctcgcagc gtccctggag accattgaca gggtaggtcc ctgttctgcg       300
     aatattgagg ttagcaatat agaggatgtt cgtgcgacca aacgcaaaca catagttgaa       360
     agggccaagt tcattctcac aggtatgttc gatgccaacc tgcccgaatc ccaggaaatc       420
     gctgacgaag tacgtcaatc cgtgcgtgtc gaagagatgc agttctttgg caagaataag       480
     aatatcccct gcggtcccaa tgttcttgat tctgatgcca ttgtagtggt agaaggacgt       540
     gccgatgtcc tgaacctgct gcgttatggt attaagaatg ctatctgtgt gggtggtacc       600
     aatgtacctc ctgaggttgc agaacttacc cggaaaaaga ccgtaacagc atttaccgat       660
     ggtgacaggg gaggcaaact cattatcaag gaactgctgc aggtagcaga tatcgattat       720
     gtggcacgtg cccccgatgg taaaactgtt gaagaccttg tacaacggga aatcatacgt       780
     gcccttcgcc agaaagtacc ggtagaacag gccatggaag cctattctat cgataaacca       840
     gctgaaaaaa ccacaacacc cagctcttca ggtccgaaaa agggtggtcg tattgccagg       900
     gttccaaaac gtgagaaaag ggtcaaacct gatcgtgcca ggaatcccgc tgccaaaatg       960
     aaaaagattg ccgagccacc tatcaaaaaa gaaaagccca aaccttccag tacaaaacct      1020
     gcaacatcgc aacatcctgt tctgaaacgt ttaagttctc attcggaatc tcttgcaggt      1080
     actcttgggg cacgcctgct tgatcaggat gataaggttg tcaatgaaac acctgtacgt      1140
     gatcttgtga atacgctgaa gaattcagaa gataatgtga aaagtgtagt gtttgatggt      1200
     gttgttaccc agcgtatact ggacatagca tccaataaag ggatcgatac cctgatcggc      1260
     gtgaaaaagg gcaatataac caaaagtcct gcaaacgtaa aggtttacac atctgcctga      1320
//

If you have problems or comments...

PBIL Back to PBIL home page