(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE243

CP001994.PE243       Location/Qualifiers
FT   CDS_pept        274218..274901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0249"
FT                   /product="phosphoglycolate phosphatase"
FT                   /EC_number="3.1.3.18"
FT                   /note="COGs: COG0561 hydrolase of the HAD superfamily;
FT                   InterProIPR005834:IPR013200:IPR006382:IPR006379:IPR 006378;
FT                   KEGG: rhi:NGR_c19510 putative phosphoglycolate phosphatase;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase type
FT                   3; Haloacid dehalogenase domain protein hydrolase; PRIAM:
FT                   Phosphoglycolate phosphatase; SPTR: Q8PZN6 Phosphoglycolate
FT                   phosphatase; TIGRFAM: SPP-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; Sucrose-phosphate phosphatase
FT                   subfamily; PFAM: haloacid dehalogenase-like hydrolase;
FT                   TIGRFAM: Sucrose-phosphate phosphatase subfamily;
FT                   HAD-superfamily hydrolase, subfamily IIB; sucrose-phosphate
FT                   phosphatase-like hydrolase, Archaeal"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35781"
FT                   /db_xref="GOA:D5E9D0"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR006382"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9D0"
FT                   /protein_id="ADE35781.1"
FT                   /translation="MMKFKALAIDIDGTITYSDRRLHFLAAEHLRNLGIPVVLATGNVL
FT                   CYAAATSKLIGLGGKVISENGGVISTGFDTNPHISESMEECEKAFSYLSNRFDLIRLDG
FT                   DLRKTEIALRRNVNADDLQASLEGAGFYIEVIDTQFALHIKSKKVNKGTGLEKMASLMD
FT                   LDVSDFIAIGDSVNDREMFEVAGYGIAVDNADPGLKLIADHVTSMSFGEGTVEALQILC
FT                   RRDFF"
     atgatgaaat tcaaagcact tgcaatagat attgacggca caatcactta cagtgatcgc        60
     cgtcttcatt ttttggcagc agaacatctg aggaatctgg gtattccggt agttcttgcc       120
     acaggaaatg tgctctgcta tgctgcagca acttccaagc ttataggact tggaggtaaa       180
     gttatctctg aaaacggagg tgtcatatcc acaggatttg ataccaatcc tcatatttct       240
     gaaagtatgg aggaatgtga aaaagcattt tcctatcttt ccaatcgttt tgacctgatt       300
     cggcttgatg gtgacctgag aaaaacggaa atcgccctga gacgcaatgt caatgcagat       360
     gatttacagg caagtcttga aggagcagga ttttatatag aagttattga cacccagttt       420
     gccctgcata taaaaagcaa aaaggtcaac aagggcacag gtctcgaaaa aatggcatcc       480
     cttatggacc tggacgtttc agattttatt gcaataggcg actccgtaaa tgaccgggaa       540
     atgttcgagg tggcgggcta tggaatcgct gtagacaatg ccgaccccgg gctgaagttg       600
     attgcggatc atgtgacctc catgtccttt ggggaaggta ccgtggaggc cctgcaaata       660
     ttatgccgga gagacttctt ttaa                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page