(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE244

CP001994.PE244       Location/Qualifiers
FT   CDS_pept        complement(274898..275155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0250"
FT                   /product="PRC-barrel domain protein"
FT                   /note="InterPro IPR007903; PFAM: PRC-barrel domain protein;
FT                   SPTR: Q12UG5 PRC-barrel protein; PFAM: PRC-barrel domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35782"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9D1"
FT                   /protein_id="ADE35782.1"
FT                   /translation="MPKVFAKNLSNKQVMTTDGTEIGILDNIVMEVKTGKLEDLMVKPD
FT                   IGLDTSKYVTDGQFLKIPFKAVRSIKDYIVVDKQIATNLD"
     atgccaaagg tatttgcaaa gaacctatcc aataaacagg tcatgacaac agacggaaca        60
     gaaattggta tactcgacaa tatagtaatg gaagtcaaaa ccggtaagct tgaagacctg       120
     atggtcaaac ccgacattgg gcttgacaca tctaaatatg ttaccgatgg ccagtttttg       180
     aagataccct tcaaagcagt acgctcaatc aaggattata ttgttgtgga taaacagata       240
     gccaccaatc ttgattaa                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page