(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE245

CP001994.PE245       Location/Qualifiers
FT   CDS_pept        complement(275173..277404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0251"
FT                   /product="AAA family ATPase, CDC48 subfamily"
FT                   /EC_number="3.6.1.3"
FT                   /note="COGs: COG0464 ATPase of the AAA+ class;
FT                   InterProIPR004201:IPR003959:IPR011704:IPR003338:IPR
FT                   003593:IPR003960:IPR005938; KEGG: gur:Gura_2842 AAA family
FT                   ATPase, CDC48 subfamily protein; PFAM: AAA ATPase central
FT                   domain protein; cell division protein 48 CDC48 domain 2;
FT                   ATPase associated with various cellular activities AAA_5;
FT                   AAA ATPase VAT domain protein; PRIAM:
FT                   Adenosinetriphosphatase; SMART: AAA ATPase; SPTR: Q12UG4
FT                   AAA family ATPase, CDC48 subfamily; TIGRFAM: AAA family
FT                   ATPase, CDC48 subfamily; PFAM: Cell division protein 48
FT                   (CDC48), N-terminal domain; ATPase family associated with
FT                   various cellular activities (AAA); Cell division protein 48
FT                   (CDC48), domain 2; TIGRFAM: AAA family ATPase, CDC48
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35783"
FT                   /db_xref="GOA:D5E9D2"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR005938"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029067"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9D2"
FT                   /protein_id="ADE35783.1"
FT                   /translation="MEELQIKVEKAHPIDFGRGIIRLDPSTLLSLQLSPGDIVLIEGKR
FT                   QTTAKVWRADRQDWGQGIARIDGYTRQNAEVGIGERITLSKAEPIPAEKILLAPPEGIV
FT                   MEFGDNTSAVIKHNILKRPFVKGDIIPIISSMGQTTPGSQAIPLIAVDTEPSDGILIIN
FT                   ENTQIQLQQKPVVGYEGAARGINYEDIGGLRTEIQRVREMIELPLKHHELFLRLNIDPP
FT                   KGVILYGPPGTGKTLIARAVASESNAYFINIAGPEIMGKYYGESEERLRKIFDEAAENA
FT                   PSIIFVDEIDSIAPKREDVTGEVERRVVAQLLTLMDGMDERKQVVVIAATNRLDSIDPA
FT                   LRRPGRFDREIEIGVPDSEDRLEILQIHTRGMPLNENIDEEYFEHLAEYTQGFVGADLL
FT                   ALVQEASMRALRRLLPDINLDEEEIPQEILEKLEVTPDDFEEALKEIEPSAMREVMVEI
FT                   PSVGWDDIGGLDLARQDISEAVEWPLKWPDKISQMGIKPPTGILLYGPPGTGKTLLAQA
FT                   VANEANANFISVKGPQILSKYVGESEKAIRDTFKKARQVAPCIIFFDEIDAISSTRQGG
FT                   SDVGSRVSEQVVNQMLTEMDGLEPLNEVVVIAATNRPDLIDPALLRSGRFDRLVMVGAA
FT                   LAEGREKIFRIHTMGIPLDSDVDIRELATMTEGYVGSDIESICREAAMLSLREDFDNEK
FT                   VSKRHFLSAMEKVKPTVNEDMIDFYNRVQEKLKGGSIRKTDAGSFAGYI"
     atggaagagt tacagataaa agtggagaaa gcacatccta tcgattttgg caggggtata        60
     atacggcttg atccgagtac cctcctgagc ctgcagcttt cccccggaga cattgtcctc       120
     atcgaaggaa agcgccaaac tacggcaaaa gtatggcgtg ctgacaggca ggattgggga       180
     cagggaattg cccgtataga tggttataca agacagaatg cagaagtggg aatcggtgag       240
     aggataacac ttagtaaggc agaaccaata cctgcagaaa agatactcct tgcaccccct       300
     gaaggaatcg tcatggagtt tggtgacaac acaagtgcgg tgatcaaaca taacattctg       360
     aaacgtccct ttgtaaaagg tgacattatt cctataatca gttcaatggg acaaactacc       420
     ccgggcagtc aggccattcc tctaatagcc gttgacacgg aaccatctga tggcatactt       480
     atcatcaatg aaaatacgca gatccagctc cagcagaaac ctgtagtggg ttatgaggga       540
     gctgccagag gtataaacta cgaagatatc ggcgggctta gaaccgaaat tcaacgggta       600
     cgtgaaatga tagaactacc gttgaaacat cacgagctct tcctgcgtct taatatagat       660
     cccccaaagg gcgttattct ctatggaccg ccgggtacag ggaaaaccct gatagcaaga       720
     gcagtagcca gcgaatctaa cgcctatttc atcaacattg ccggcccgga aataatggga       780
     aaatactacg gggaaagtga ggaaaggctg cgaaaaatat ttgatgaagc tgcggagaat       840
     gccccttcaa taatatttgt tgacgaaatc gattcaattg caccaaaaag ggaagacgtg       900
     accggagaag tcgagagaag ggtcgttgcc cagcttctca ccctgatgga cggaatggat       960
     gaacgtaaac aggtagttgt aattgcagcc acaaacaggc ttgattctat tgacccggcc      1020
     ctgcgccgcc cgggcagatt tgacagggaa atcgagatcg gagttcccga tagtgaagac      1080
     cggctcgaaa tactccagat ccacacccgc ggaatgccac tgaacgaaaa tatcgatgaa      1140
     gaatattttg aacatctggc agaatatacc cagggttttg tgggagccga cctattagcc      1200
     cttgtacagg aagcatcaat gcgggcactt aggagattac ttcccgacat caatctcgac      1260
     gaagaggaaa ttccacagga aatactcgaa aaactggaag tcacgcccga tgacttcgag      1320
     gaagccctga aggagattga accctcggca atgagggaag ttatggtcga aataccgtct      1380
     gtgggatggg atgatattgg cgggcttgat ctggccagac aggacatcag cgaagcagtc      1440
     gaatggccgc ttaaatggcc cgataaaatc agccagatgg gaatcaaacc ccctacagga      1500
     atacttttat atggacctcc aggaacaggt aaaactctgc ttgcccaagc tgtggcaaac      1560
     gaagccaatg ccaatttcat cagtgtcaaa ggaccccaga tattgtccaa atacgtaggg      1620
     gaatctgaaa aagcaattcg tgatactttc aaaaaagcac gacaggttgc gccctgtata      1680
     atattctttg atgagatcga tgcaatctct tcgacaaggc aagggggtag tgatgtaggt      1740
     agccgtgtct cagaacaggt ggtaaatcag atgcttaccg agatggatgg acttgaaccc      1800
     ctgaatgaag tggttgtcat tgcggccacc aacagacctg accttattga cccggcatta      1860
     ctgcgatcag gaaggtttga caggcttgta atggtcggag ccgcactcgc agagggcagg      1920
     gaaaaaatat tccggattca cacaatgggt atacccctgg atagcgatgt tgacataagg      1980
     gaacttgcca caatgactga aggctacgtt ggatctgata tagaatctat atgcagggag      2040
     gcagcaatgt tatccctgag agaagatttc gataatgaaa aggtaagtaa aaggcatttc      2100
     ctttcagcta tggaaaaagt aaaaccaacg gtcaatgagg acatgatcga cttctacaac      2160
     cgggttcagg aaaaactaaa aggcggatca atccgcaaga cagatgcagg atcatttgca      2220
     ggatatattt aa                                                          2232
//

If you have problems or comments...

PBIL Back to PBIL home page