(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE246

CP001994.PE246       Location/Qualifiers
FT   CDS_pept        277581..277784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0252"
FT                   /product="deoxyribonuclease/rho motif-related TRAM"
FT                   /note="COGs: COG3269 RNA-binding protein contains TRAM
FT                   domain; InterPro IPR002792; KEGG: dol:Dole_1585 RNA
FT                   methyltransferase; PFAM: deoxyribonuclease/rho
FT                   motif-related TRAM; SPTR: Q12YA1 Putative uncharacterized
FT                   protein; PFAM: TRAM domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35784"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9D3"
FT                   /protein_id="ADE35784.1"
FT                   /translation="MFERVESSAPVESGETYDVVIEDIAKKGDGIARIDGFVIFVPETE
FT                   VGDELSIKVTKVLSKFAFGEVV"
     ttgttcgaac gtgttgaatc aagtgctccg gtagaatctg gagaaaccta cgatgttgtg        60
     attgaagata ttgccaagaa aggcgacgga atagctcgta ttgacgggtt tgtcattttt       120
     gtgcccgaaa cagaagtggg cgatgaactt tcaattaaag taaccaaagt cctttcgaaa       180
     ttcgcttttg gagaagtagt ctga                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page