(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE25

CP001994.PE25        Location/Qualifiers
FT   CDS_pept        25560..26024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0025"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q12VJ5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35563"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8Q4"
FT                   /protein_id="ADE35563.1"
FT                   /translation="MQRRGLLFLLLILILFSSGCSDIGDTVKDVNETVTQSKEDVEYLK
FT                   WMKASIDIIHSDYVDIKQALEDRDVATLEKAAGNLTSHCSKAKGTMQSFNPSPSLQPVT
FT                   DRYSQILNQSCSLGTFLEENAATLNFTNETTLQKVEKNMGLVNNSLILNN"
     ttgcagagga gaggcctgct ttttttgtta ttgatcttaa tactgtttag ttcagggtgt        60
     tctgatatag gggatacggt aaaagatgtt aatgaaaccg ttactcagag caaggaagat       120
     gttgagtacc tgaaatggat gaaggcttcg atcgatatca tccattccga ttatgtcgat       180
     atcaaacagg ctcttgaaga ccgtgacgtg gccacactcg aaaaggctgc cgggaatctt       240
     accagtcact gcagtaaagc caaagggaca atgcaatcct tcaatccatc tcccagcctg       300
     caacctgtga ctgacaggta cagtcaaatt ctcaatcaat cctgcagtct gggtaccttt       360
     ctggaagaaa atgcagccac ccttaatttt acaaacgaaa caaccctgca gaaagttgag       420
     aaaaatatgg gtcttgtaaa taattcgtta atactcaata attga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page