(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE262

CP001994.PE262       Location/Qualifiers
FT   CDS_pept        290742..291389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0268"
FT                   /product="TfuA domain protein core"
FT                   /note="COGs: COG3482 conserved hypothetical protein;
FT                   InterPro IPR012924; KEGG: scl:sce9073 hypothetical protein;
FT                   PFAM: TfuA domain protein core; SPTR: Q12UD1 TfuA-like
FT                   protein; PFAM: TfuA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35800"
FT                   /db_xref="InterPro:IPR012924"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9E9"
FT                   /protein_id="ADE35800.1"
FT                   /translation="MKTIVFAGTSIGLEEAGKLSGATVHGPVKRGDVTQAVKQGYDLIG
FT                   IIDGIFFHRAAVGHREILEALRKNVTIVGGCSMGALRASEMDRHGMIGVGKIYEWYRDG
FT                   VIEDDDEVAVTTNPETYESISAPLVNIRCTFLSAMDEGIISAGQEAFLLDIAKATHYSL
FT                   RSYYGIIKSARDKGMLDEKTAAFLLDFCRDREVDIKRKDALAVLSRIKELNI"
     atgaaaacaa tagtttttgc cggcaccagt ataggccttg aagaagcagg aaaactcagt        60
     ggtgcaaccg tccacggccc agttaagcgc ggggatgtta cacaggctgt aaaacagggt       120
     tatgatttga ttggtatcat tgatggtatt tttttccaca gggctgcagt tggtcacagg       180
     gaaatactgg aagccctgcg caaaaatgta acaattgttg gtggatgtag catgggagct       240
     ttgcgtgcat ccgaaatgga tcgccacgga atgataggtg tgggtaaaat ctatgaatgg       300
     tatcgcgatg gtgttattga agatgatgat gaagtggcgg tcaccacaaa ccctgagacc       360
     tatgagtcca tttctgctcc gcttgtgaat atccggtgta ccttcctctc tgctatggat       420
     gagggcatca tttcggccgg tcaggaggcc ttcctgctgg atattgcaaa agctacccat       480
     tattctctga ggagctatta cggcataata aaaagtgccc gggacaaagg aatgctggat       540
     gagaaaacag cagcattttt acttgatttt tgtcgtgaca gggaagtcga tatcaaaaga       600
     aaagatgccc tggcggttct ttccagaata aaggagttga acatttaa                    648
//

If you have problems or comments...

PBIL Back to PBIL home page