(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE263

CP001994.PE263       Location/Qualifiers
FT   CDS_pept        complement(291392..291811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0269"
FT                   /product="iron (metal) dependent repressor, DtxR family"
FT                   /note="COGs: COG1321 Mn-dependent transcriptional regulator
FT                   protein; InterPro IPR000835:IPR001367; KEGG: tcx:Tcr_0904
FT                   iron dependent repressor; PFAM: iron dependent repressor;
FT                   regulatory protein MarR; SMART: iron dependent repressor;
FT                   SPTR: Q12UD0 Iron dependent repressor; PFAM: Iron dependent
FT                   repressor, metal binding and dimerisation domain; Iron
FT                   dependent repressor, N-terminal DNA binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35801"
FT                   /db_xref="GOA:D5E9F0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9F0"
FT                   /protein_id="ADE35801.1"
FT                   /translation="MEKITGLELSPRKIEYLKYIHKKKENVRTNELSAHLQVDPSTTTK
FT                   TINELAEEGYVNHVPYRGVRLTEKGKEYAAFLIRRHRILSLMLKNYGLSPEEACSEVKR
FT                   FESFVSLQAIDTICSTMGHPTMGVCGKIEHPHCDV"
     atggaaaaga ttacagggct tgagctttct ccacgtaaaa tagaatatct caaatatatt        60
     cataagaaaa aagaaaatgt acgcaccaat gaactttcag cccaccttca ggtagaccct       120
     tctacaacaa ccaaaacaat caatgaactt gcagaggagg gatacgtcaa tcatgtacct       180
     tatcgtggag taagacttac agagaaaggg aaagaatatg ctgcttttct gattcgcaga       240
     cacaggatat tgagccttat gctcaaaaac tatggcctct cacctgaaga agcctgcagt       300
     gaggtgaagc gttttgaaag ttttgtttcc cttcaggcta tcgataccat atgcagtacc       360
     atgggccatc cgactatggg agtgtgtggc aaaatagagc acccccactg tgacgtataa       420
//

If you have problems or comments...

PBIL Back to PBIL home page