(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE264

CP001994.PE264       Location/Qualifiers
FT   CDS_pept        complement(291858..293153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0270"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG3174 membrane protein; InterPro IPR003416;
FT                   KEGG: har:HEAR1033 hypothetical protein; SPTR: Q12UC8
FT                   Putative uncharacterized protein; PFAM: MgtC family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35802"
FT                   /db_xref="GOA:D5E9F1"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="InterPro:IPR025105"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9F1"
FT                   /protein_id="ADE35802.1"
FT                   /translation="MEIVPTIGLDPFLFNFLQKLILSLMIGIIIGIEREHRRAEHPVFA
FT                   GVRTYALAAVTGMLATIAGKTIGNDIIVAAAVLIIACSIALIYRTYTMRGKLGMTSALS
FT                   LFCTFLLGILVANGNYLFAIAGGVAITFLTIEKRPLHSFAQNLSNEDILNSLQFLAVAF
FT                   ILYPLVPAEELWGIVDLKATILIVVLVMFIGFISYISLKRFGAGGGISYSGLLGGFVSS
FT                   EATTAALASIAKEKSGFVNAFYIGILLSNLSMFISNLLIALIVDNSGKTTLNMLPPQLL
FT                   MILVVIGIFWKNKNISKKMEGTLDIGSPFALKPALRFGAIFLVLQIFATFANEYAGTYG
FT                   TYVTALGGVASSSAVTASMASLAVKGEISYMLAGETAVIAGIVSTLNKITYIRIAGALE
FT                   LEKRARMTLMILSIVGIIGLVVWIYADVKPVF"
     atggaaattg tacccaccat cgggcttgat ccttttttat ttaattttct gcaaaaactc        60
     atcctatccc tgatgatagg tataatcatc gggatagaaa gagaacatag aagagcagaa       120
     catccggttt ttgcaggtgt gcgtacatat gcccttgctg ctgtcacagg catgctggca       180
     acaattgcag gaaaaacaat cggtaatgat attatagttg ccgcggccgt tttgataata       240
     gcatgcagta ttgccctgat ataccgtacc tacactatgc ggggcaagct gggcatgaca       300
     agtgctcttt ctctcttctg cacctttctg ctgggaatac tggtagcaaa cggtaattac       360
     ctttttgcta ttgccggtgg agttgcaata actttcctga ctattgaaaa acgccccctc       420
     cattcttttg cccagaatct ttccaatgaa gatatcctga acagcctgca gttccttgcc       480
     gtggctttca tcctgtatcc cctggtacct gctgaagaac tatggggcat tgtggatctt       540
     aaagctacaa tccttattgt cgtactcgtg atgtttattg gatttatcag ctacatttcc       600
     ctcaaacgct tcggagcagg aggaggcata tcctattctg gattgttggg aggatttgtg       660
     agcagtgaag ccaccactgc ggccctggct tcgatagcaa aggaaaaatc cgggtttgta       720
     aacgcttttt acatcgggat ccttttatcc aacctttcca tgttcatcag taacctgtta       780
     attgccctga ttgtagataa ttcaggcaag accaccctga atatgttacc tccgcaatta       840
     ttgatgatac tggtagtaat agggattttc tggaaaaaca agaatatatc taagaaaatg       900
     gaaggaaccc ttgacatcgg ttcccccttt gctctcaagc ctgcactgcg ttttggagca       960
     atctttttgg tattacagat ctttgcaact tttgccaacg agtacgcagg aacgtatggc      1020
     acatatgtaa ctgcactggg aggtgtcgcc agcagttcgg cagtgacagc ttcgatggca      1080
     tcccttgcag taaaaggaga aatttcgtac atgctggctg gcgaaaccgc agtcattgcc      1140
     ggtattgtga gcacactcaa caaaatcaca tacattcgga ttgcaggtgc attggaactt      1200
     gaaaaaagag cccgtatgac attgatgata ttatctattg tgggaattat cgggcttgtt      1260
     gtatggatat atgcagatgt taaacctgtc ttctga                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page