(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE265

CP001994.PE265       Location/Qualifiers
FT   CDS_pept        complement(293191..293475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0271"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dol:Dole_3055 hypothetical protein; SPTR:
FT                   Q8PT46 Methyltransferase; PFAM: Rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35803"
FT                   /db_xref="GOA:D5E9F2"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9F2"
FT                   /protein_id="ADE35803.1"
FT                   /translation="MLSKIPIDLDAVEDENIDKEILRAGIIAELDAINLYEQMAELASS
FT                   EEIRAVLLDIAKEEKTHVGEFQTMLLEYDDEQGDELEAGRKEVEEEILK"
     atgttatcaa agataccaat tgaccttgat gctgtagagg atgagaacat agataaggag        60
     atcttaaggg ctggcattat agccgaactt gatgctatca acctctatga acagatggcc       120
     gaacttgctt ccagcgagga gatccgggca gtgctattgg acatcgcaaa ggaagagaag       180
     acccacgtag gagaattcca gaccatgctg cttgaatacg atgatgagca gggggatgaa       240
     ctggaagcag gcaggaaaga agttgaagaa gagattctca aataa                       285
//

If you have problems or comments...

PBIL Back to PBIL home page