(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE270

CP001994.PE270       Location/Qualifiers
FT   CDS_pept        complement(296456..298372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0276"
FT                   /product="coenzyme F420 hydrogenase/dehydrogenase beta
FT                   subunit domain protein"
FT                   /note="COGs: COG1035 Coenzyme F420-reducing hydrogenase
FT                   beta subunit;
FT                   InterProIPR006066:IPR006067:IPR001450:IPR007516:IPR
FT                   007525:IPR005117:IPR017900; KEGG: gur:Gura_3941 nitrite and
FT                   sulphite reductase 4Fe-4S region; PFAM: coenzyme F420
FT                   hydrogenase/dehydrogenase beta subunit domain protein;
FT                   nitrite and sulphite reductase 4Fe-4S region; 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein;
FT                   nitrite/sulfite reductase hemoprotein beta-component
FT                   ferrodoxin domain protein; SPTR: Q12Y86 Nitrite and
FT                   sulphite reductase; PFAM: Coenzyme F420
FT                   hydrogenase/dehydrogenase, beta subunit N-term; 4Fe-4S
FT                   binding domain; Nitrite and sulphite reductase 4Fe-4S
FT                   domain; Nitrite/Sulfite reductase ferredoxin-like half
FT                   domain; Coenzyme F420 hydrogenase/dehydrogenase, beta
FT                   subunit C terminus"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35808"
FT                   /db_xref="GOA:D5E9F7"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007516"
FT                   /db_xref="InterPro:IPR007525"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9F7"
FT                   /protein_id="ADE35808.1"
FT                   /translation="MADKKWFLKDNIVDTGMCTLCGACAAICPYDLIRFDENGPHLKDE
FT                   CYRNGEGACKDVCQRVMTDASRIALNAFDFKAKPPSLLGQYEKIVSARATDEDLIKKGQ
FT                   DGGAVSSLIAYCIDNGLIDGAITTAGFAKPAANIIGEREDITSSQGAKYSTVPVLSALR
FT                   DQKDNFNKVAVVGTPCQTYGVRRMQYFNGLNVHPVEKGMDGESANTPKIEYVIGLFCME
FT                   NFNYHKLSDFLEKQGIKLNDIKKYSIQLDEMIITTDEKNIEISLKDLQDCVWDGCKICR
FT                   DAVSKVADISAGSSGSSKGWTTLIARNAKGLKLLNDANEAGYIEISNEVDIEMTKELAQ
FT                   FKIRKFRHELDKRLDSEKKVSYYWVRDYPGVRPEINGTNFVKIKTDSGITTHEYLGKVA
FT                   ELAEKYGDGTLEMTARKSIEIQGVPGRNIDDLMAEVYDAGLKTIGMGYATACPGMDYCP
FT                   EGLVSTKELANKLTMHFAQKLTPHKMKVGVAGCPNSCVRVRDHDIGIMGQLMPVIDETK
FT                   CTGCGRCTELCKFNAISIEGGKAVINRDLCGNCGWCVRGCPHEAALEDKRGYSLWIGGN
FT                   GARRPTEGVLIKSFCDEEEIIETINDIARAFIKYRTNPGKERLGNIMDKIGQGTLIKEI
FT                   MEN"
     atggcagata aaaaatggtt cttaaaagat aatattgtag atacaggcat gtgtaccctt        60
     tgtggtgcat gtgctgctat ttgtccatat gaccttatac gttttgatga aaacggaccg       120
     caccttaaag acgagtgcta caggaatgga gaaggagcat gcaaagatgt atgccaacgg       180
     gtaatgaccg atgcttcccg gattgcactt aatgcttttg attttaaggc aaaacccccc       240
     agcttgttgg gtcaatacga aaaaatagtg tctgcaagag caacagatga ggatctcatc       300
     aaaaaaggac aggacggagg agccgtctct tcccttattg catactgtat tgataatggg       360
     ctcatagacg gagccataac aacagccggt tttgccaaac ctgcagcaaa cataattgga       420
     gaaagggaag atataacttc atcccaggga gccaaatatt caacagtgcc tgtattatcc       480
     gccctaaggg atcaaaaaga taatttcaac aaagtagcag tcgtaggaac tccatgtcag       540
     acctatggcg tccgtagaat gcaatatttc aatggcctta acgtgcaccc tgtcgaaaaa       600
     ggaatggatg gggaaagtgc caatactcct aaaattgaat atgtaattgg cctcttttgc       660
     atggaaaatt tcaattatca caagttatcc gatttcctgg aaaaacaggg aatcaaactt       720
     aacgatatta aaaaatattc cattcaactt gatgaaatga ttataaccac ggatgagaaa       780
     aatattgaaa tctccctgaa ggaccttcag gattgtgttt gggatggctg taagatttgc       840
     agggacgcag tatcaaaggt cgctgatatt tctgcaggaa gctccggttc ttcaaagggg       900
     tggactacat tgatagcccg caatgccaaa ggattgaaat tgcttaatga tgcaaatgaa       960
     gcgggttata ttgagatatc aaatgaagta gatattgaaa tgacaaaaga actggcacaa      1020
     ttcaaaatca gaaagttccg tcatgaactt gacaaacgtc tcgattcaga aaaaaaagtc      1080
     agctactact gggttcgtga ctatccgggt gtaaggccag aaataaatgg aaccaacttt      1140
     gtcaaaataa aaaccgattc agggattacc acacacgaat atctgggaaa agttgcagaa      1200
     cttgccgaaa aatatggtga cggtacactg gaaatgactg caaggaaaag tatcgagatc      1260
     caaggtgtgc ctggaagaaa cattgatgat cttatggcag aggtatacga cgcgggattg      1320
     aagacaatcg gaatgggata tgctacagca tgcccgggaa tggattattg ccccgaaggc      1380
     ctggtgagta caaaagaact tgccaacaaa cttacaatgc attttgccca gaaattgacg      1440
     ccacataaaa tgaaagtagg tgtcgcaggc tgtccaaata gttgtgtccg cgtaagagac      1500
     catgacatag gtataatggg ccagctcatg cctgtcattg atgaaacaaa gtgcactggc      1560
     tgtggaagat gtaccgaact atgtaaattt aatgctatat ccatagaagg aggaaaagca      1620
     gttataaacc gggatctttg tggaaattgt ggatggtgtg tcagaggatg tccccatgaa      1680
     gctgccctgg aagataaacg cggttactct ttatggatag gaggtaatgg tgcacgccgt      1740
     cctacagagg gagtattaat caaatcattc tgtgacgagg aagaaatcat agagacgatc      1800
     aatgatatag ctagagcatt cataaaatac cgcacaaacc ccggtaaaga aagattgggg      1860
     aatattatgg acaaaatagg ccagggaact cttatcaaag aaatcatgga aaactga         1917
//

If you have problems or comments...

PBIL Back to PBIL home page