(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE275

CP001994.PE275       Location/Qualifiers
FT   CDS_pept        complement(301301..302383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0281"
FT                   /product="protein of unknown function DUF201"
FT                   /note="COGs: COG0458 Carbamoylphosphate synthase large
FT                   subunit (split gene in MJ); InterPro
FT                   IPR003806:IPR020561:IPR011761; KEGG: bpr:GBP346_A2048
FT                   argininosuccinate lyase 2 (arginosuccinase 2) (asal 2);
FT                   PFAM: protein of unknown function DUF201;
FT                   Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain;
FT                   SPTR: Q12UB8 Putative uncharacterized protein; PFAM:
FT                   ATP-grasp domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35813"
FT                   /db_xref="GOA:D5E9G2"
FT                   /db_xref="InterPro:IPR003806"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR023890"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9G2"
FT                   /protein_id="ADE35813.1"
FT                   /translation="MKTICLIGGKLQGFEVAYLARKSGIRVHLVDRKNKPLIHNCVDEH
FT                   FCFDITERPERLIELSRHSDAIIPTNENLDTLLFLKKIEPELHCPLLFDFTAYDTSMDK
FT                   KRSKEYFKSIDIPIPSEKPQNPPYFVKPPCMSSSKGARIIDNDSELANIDDSMVIEEYV
FT                   PGPVVSLEVVGDGNNFMIGQQTQVHIDQEHDCHRVTPMETDPIFREITHLLASNLYLKG
FT                   IMDVEAILSPEGIRVIEIDARFPSQTPTVVYHSGGVNLLEWLMGSFAGKIKDNKPLPVG
FT                   KQCNYEHLMAVDGKLIPVGEHVLSDGDDYRLFHESNGLEIFKCRGKRQTYTLICTGATR
FT                   HEMCYKRKKAIQLIKSDMKQ"
     atgaaaacga tatgtctgat tgggggcaaa ctgcagggct tcgaagtggc ttatcttgcc        60
     agaaaatccg ggattcgggt acatctggtc gacaggaaaa acaagccact gatacataat       120
     tgtgtggatg aacatttttg ctttgatatt acagaaaggc cggaaaggct catagaatta       180
     tcccgccact cagatgctat aatcccgaca aatgaaaacc ttgacaccct tctctttttg       240
     aaaaaaatag aaccagaact acattgcccc cttcttttcg attttaccgc ttatgatacc       300
     agcatggaca aaaaacgttc aaaggaatat ttcaaatcga tagatatacc cattccttcg       360
     gaaaaacccc aaaatcctcc ttattttgtg aaacccccct gcatgagcag cagtaagggg       420
     gcacgcataa ttgacaacga cagtgaactg gcaaacattg atgattcgat ggtcattgaa       480
     gaatatgtac ccggaccagt agtttcactg gaagtggtgg gagacgggaa caatttcatg       540
     atcggtcagc agacacaggt acatattgac caggaacatg attgccatcg ggtcaccccg       600
     atggagactg acccaatttt cagggagatc acacatctgc tggccagcaa tctatacctt       660
     aaaggaatca tggatgtgga agcaatactc tcccccgaag gaatccgggt tattgagatt       720
     gatgcacgtt ttcccagcca gacacctacc gtagtatatc acagtggtgg tgtaaacctg       780
     ctcgaatggc taatgggaag ttttgcagga aaaataaagg ataacaaacc tcttcctgtt       840
     ggtaaacaat gtaactatga gcacctgatg gcagtcgatg ggaaacttat ccctgttggg       900
     gaacatgttc tttcagacgg tgatgactac cggctattcc atgaatcaaa cgggttggaa       960
     atattcaaat gcaggggaaa aagacaaacc tataccctga tatgcactgg cgctacccgg      1020
     catgagatgt gttacaaaag aaaaaaagca attcaactca tcaaatccga tatgaagcag      1080
     taa                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page