(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE277

CP001994.PE277       Location/Qualifiers
FT   CDS_pept        complement(303443..304657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0283"
FT                   /product="Pyrrolysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.26"
FT                   /EC_number="6.1.1.-"
FT                   /note="InterPro IPR002314:IPR006195:IPR012739; KEGG:
FT                   dat:HRM2_15230 hypothetical protein; PFAM: tRNA synthetase
FT                   class II (G H P and S); PRIAM: Pyrrolysine--tRNA(Pyl)
FT                   ligase; SPTR: Q12UB6 Pyrrolysyl-tRNA synthetase; TIGRFAM:
FT                   pyrrolysyl-tRNA synthetase; PFAM: tRNA synthetase class II
FT                   core domain (G, H, P, S and T); TIGRFAM: pyrrolysyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35815"
FT                   /db_xref="GOA:D5E9G4"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012739"
FT                   /db_xref="InterPro:IPR023877"
FT                   /db_xref="InterPro:IPR023878"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9G4"
FT                   /protein_id="ADE35815.1"
FT                   /translation="MERKPLDLLIDTNGVWLSRNGLLHGVKNFEVSRNHIHITTDCQSR
FT                   FTVRNSRRSRSARALRNNKYRKACKNCKLSDERITRFVTKDFGRGSQARVITSSKTKKS
FT                   KSPKEAVVKSVSSKANEMPPVVEAKKEKPVKPDYTPAQKKRITTLLSPADDLSSIKELP
FT                   TFKELETELVKKRKQDLRQMYEDDRRHQLAQLERDISLFLIEKGFMEVRTSVLIPAKFI
FT                   ERMGITEEDPLYKQIFRVDENTCLRPMLAPGLYNYLHNFDNIMPDPLKIFEIGTCYRKE
FT                   SDGKEHLEEFTMVNFCQMGSGCTKENLLNIIDDLLKYLNIDYEVISDNCMVYGDTIDIM
FT                   HGDMEISSAVVGPIPQDLDWGVTKPWMGAGMGIERLLKVKHKYTNIKRSSRSISYYNGI
FT                   TTNLR"
     atggaaagga aaccactaga tttacttata gacaccaacg gagtgtggct ctctaggaac        60
     gggttacttc atggtgtaaa gaacttcgag gtgtcaagaa accatattca tatcactact       120
     gactgccaaa gccgctttac agtacgcaat tcaagaagaa gtcgctctgc aagggcgcta       180
     cgcaacaata aatatcgcaa agcatgcaaa aactgcaaac tttccgatga gcgtattact       240
     cgttttgtca caaaagattt tggcagggga agccaggcac gtgttatcac atcttcaaaa       300
     acaaaaaaga gtaaatctcc aaaggaagca gtggtaaaat ctgtatccag caaggcaaat       360
     gaaatgccac ctgttgtaga ggcaaaaaaa gaaaagcctg taaaaccgga ttacacgcct       420
     gcccagaaga aaaggattac aacactgctt agccctgcag acgaccttag ttcaataaaa       480
     gaactcccca ccttcaagga gctggagaca gaacttgtta aaaaaagaaa acaagacctg       540
     cgccagatgt atgaggatga ccgcagacat cagctggccc agctcgaaag ggacatctcc       600
     ctatttttaa tagaaaaagg attcatggaa gtacgtactt ctgtcctgat acctgccaaa       660
     ttcattgaaa gaatgggcat cacagaagaa gaccccctct acaagcagat cttccgggtg       720
     gatgagaata catgcctgcg gcccatgctt gccccgggat tatataatta tcttcacaat       780
     tttgataaca taatgcccga ccccctcaag atattcgaga tcggtacctg ctacagaaag       840
     gaatccgacg gcaaagaaca tcttgaagag tttacaatgg ttaatttctg ccagatgggt       900
     tcgggatgca caaaagaaaa cctgttaaat attatcgatg acctgctcaa atatctaaac       960
     atcgattacg aagtaatctc ggataattgc atggtgtatg gagataccat tgacataatg      1020
     catggggata tggaaatatc ttcagccgtt gtgggaccca ttccacagga cctcgactgg      1080
     ggagtgacca aaccctggat gggtgcagga atgggaattg agagattact caaggtaaag      1140
     cacaaataca caaacataaa gcgctcaagc aggtctattt catactataa cggaattaca      1200
     accaatctca ggtga                                                       1215
//

If you have problems or comments...

PBIL Back to PBIL home page