(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE281

CP001994.PE281       Location/Qualifiers
FT   CDS_pept        309302..309685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0287"
FT                   /product="transcriptional regulator, TrmB"
FT                   /note="COGs: COG3355 transcriptional regulator protein;
FT                   InterPro IPR002831; PFAM: transcriptional regulator TrmB;
FT                   SPTR: Q12UA5 Transcriptional regulator TrmB; PFAM:
FT                   Sugar-specific transcriptional regulator TrmB"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35819"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9G8"
FT                   /protein_id="ADE35819.1"
FT                   /translation="MTGSISEMLKANCECDDVAKCILGLKDLDLKAYKILLSNGPLTAE
FT                   KLGKYLDRERSTAYRSLQNLISCGLVYRETHTIDVGGYFYEYVAVNPAEVRRMLQESVD
FT                   QWYDKVSHLINKIDKELVGDEIP"
     atgacgggtt caatttcgga aatgctgaaa gcgaattgtg aatgcgatga tgttgccaag        60
     tgtattctgg gcttaaaaga cctggatcta aaggcttata agatactgct ttccaatggt       120
     cctctgacag ccgaaaaact cgggaagtat ctggatcgtg agcgcagtac agcttatcgt       180
     tctctccaga acctgatctc ctgcggactc gtttacaggg aaacccatac cattgatgta       240
     gggggttatt tttatgaata cgtggctgta aaccctgcag aggtcaggcg aatgcttcag       300
     gaaagtgttg accagtggta tgataaagtg agtcatctga ttaataaaat cgataaggaa       360
     cttgtagggg acgaaattcc ataa                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page