(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE287

CP001994.PE287       Location/Qualifiers
FT   CDS_pept        314189..315127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0293"
FT                   /product="RNAse Z"
FT                   /EC_number="3.1.26.11"
FT                   /note="COGs: COG1234 Metal-dependent hydrolase of the
FT                   beta-lactamase superfamily III; InterPro
FT                   IPR001279:IPR013471; KEGG: afw:Anae109_4169 ribonuclease Z;
FT                   PFAM: beta-lactamase domain protein; SPTR: Q46BL2
FT                   Ribonuclease Z; TIGRFAM: ribonuclease Z; PFAM:
FT                   Metallo-beta-lactamase superfamily; TIGRFAM: ribonuclease
FT                   Z"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35825"
FT                   /db_xref="GOA:D5E9H4"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9H4"
FT                   /protein_id="ADE35825.1"
FT                   /translation="MLLLMIFIMLRVVFLGTGGALPTVNRNPSSILVNRDGELLLFDCG
FT                   EGTQQQMMRARTGMMSLSSIFISHFHADHVLGIPGLLQTLSFHGRDTPLTIYGPVWVEQ
FT                   FVKLVSLLGYCRLNFEVKAVPLEAGDVVQREGYVVNAIASEHSVPSLAYALVENERPGK
FT                   FDRRRAEEMGVPVGPLYSRLQKGESVEVNGRIIHPNEVIGPSRRGRKLIYTGDTRPCEA
FT                   ILEASKNADVLIHDGTLAQEKADWARESLHSTANEAADVAKKAGVKRLILTHISSRYTD
FT                   DSSVLLEEAKEVFEKTCVADDLMEFEVLYGE"
     atgcttttac ttatgatatt tattatgctt cgtgtagtgt tccttggtac agggggagct        60
     ctcccaactg tgaacaggaa tccctcttct attctggtaa acagggacgg ggagttgctg       120
     ctttttgact gtggggaggg tacccagcag caaatgatgc gtgccaggac tggcatgatg       180
     tccctatctt ctattttcat ttcacatttt catgcagatc atgtgctggg aattcccggc       240
     cttttgcaaa ctctttcttt ccacggcagg gatactccac tgactatata tggtcccgtc       300
     tgggtggaac aatttgtaaa actggtctca ctacttggct actgccgatt gaattttgag       360
     gtcaaagcag taccccttga agccggggat gttgtccagc gagaaggtta tgtggtcaat       420
     gcaattgcaa gtgagcacag tgttccttct cttgcctatg ctcttgtaga aaatgaacgc       480
     cctggcaaat ttgaccgccg tcgtgctgaa gagatgggtg tacctgtagg cccactttat       540
     tcccgtctcc agaaagggga atctgtagaa gtaaatggca ggatcatcca tcccaatgaa       600
     gtgataggtc cttcccgtag ggggcgtaaa ctcatctata ctggtgacac ccgtccgtgt       660
     gaggccattc ttgaagcaag taaaaacgct gatgtattga ttcatgatgg cacacttgca       720
     caggaaaaag cggattgggc ccgtgaatca ttgcattcga cagcaaatga ggctgcggat       780
     gtggcaaaaa aagcaggggt aaagcggctc attctgaccc atatcagttc gaggtatact       840
     gacgattctt ctgtacttct ggaggaggca aaagaagttt ttgaaaaaac ctgtgtggca       900
     gatgacctga tggagtttga agtcctctat ggggaataa                              939
//

If you have problems or comments...

PBIL Back to PBIL home page