(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE289

CP001994.PE289       Location/Qualifiers
FT   CDS_pept        complement(315424..316527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0295"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="COGs: COG1223 ATPase (AAA+ superfamily); InterPro
FT                   IPR003959:IPR003593:IPR003960; KEGG: hypothetical protein;
FT                   PFAM: AAA ATPase central domain protein; SMART: AAA ATPase;
FT                   SPTR: Q8TLK7 ATPase, AAA family; PFAM: ATPase family
FT                   associated with various cellular activities (AAA)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35827"
FT                   /db_xref="GOA:D5E9H6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9H6"
FT                   /protein_id="ADE35827.1"
FT                   /translation="MARSAQRSSLKKIPQEAIEAKEATAEIVILQPIGYPLCGIIEEYP
FT                   RIEEPELFECYARMQWNGYIARKNDYLFDQRMFPDFAYRIQEVRPEDTIIGQSTTIVVN
FT                   QEEKEKTDIEYPVEIAFDDIVGQVKAKRKCKLIERYLEEPERFGKWAPRNILFHGPSGT
FT                   GKTMVAKALANKTDVAFLPIKATQLIGEFVGEGSRQIHQLYEKAGELAPSIIFIDELDA
FT                   IALDRRYQELRGDVAEIVNALLTEMDGISQSEGVCTICATNRTAVLDGAVRSRFEEEIE
FT                   FVLPGKEERKEIIKLNLQTFPIKAEANVDELAKLTNGLSGRDIVEKILKSALHNAIMDD
FT                   MEKVEAHYFEKAASGLQKKETNTHLYV"
     atggcaagat ccgcacaacg ttccagtctg aaaaaaatac cccaggaagc aatcgaggca        60
     aaagaagcta ctgcagaaat tgtaattttg caacctattg gttatcctct ctgtggaatt       120
     attgaagaat acccgcgcat cgaagaacca gaactctttg aatgttacgc gagaatgcaa       180
     tggaatggtt acattgcccg aaaaaacgat tacctctttg atcaacgaat gttccctgat       240
     tttgcataca ggatccagga agtaaggccc gaagacacaa taataggcca atccactaca       300
     attgtagtaa atcaggaaga gaaagaaaaa accgatatcg aatatcccgt ggaaattgca       360
     tttgatgata tagtaggaca ggttaaagca aaacgcaaat gcaagctcat cgagcgatac       420
     ctggaagagc ccgagagatt tggcaaatgg gcaccccgta acatcctgtt tcatggacca       480
     tcaggtacag gaaagaccat ggtcgcaaaa gctcttgcaa ataaaactga tgtggcattc       540
     ctcccgatca aagccacaca acttatagga gaatttgtgg gagaaggttc cagacagata       600
     caccagctat atgaaaaagc tggtgaactt gcacccagca ttattttcat agacgagctg       660
     gatgccattg cccttgacag gcgataccag gaactcaggg gcgatgtagc cgagatcgtc       720
     aacgccctgc tcacagaaat ggacggcatc agccaaagtg aaggagtatg caccatctgt       780
     gccacaaaca gaacagcagt acttgacggg gcagtcagga gccgttttga agaggagata       840
     gagtttgtac ttcccggtaa agaggaaaga aaagaaataa taaaattaaa tctacagaca       900
     ttccccataa aagctgaagc taacgtggat gaacttgcaa aactgaccaa cggcctttcg       960
     ggaagagata ttgtggaaaa aattctcaaa agtgcccttc acaatgcaat aatggatgac      1020
     atggaaaaag ttgaagcaca ttattttgaa aaagctgcgt cagggttgca gaaaaaggaa      1080
     acaaataccc acctttacgt ctga                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page