(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE291

CP001994.PE291       Location/Qualifiers
FT   CDS_pept        316901..317266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0297"
FT                   /product="response regulator receiver protein"
FT                   /note="COGs: COG2204 Response regulator containing
FT                   CheY-like receiver AAA-type ATPase and DNA-binding domains;
FT                   InterPro IPR001789; KEGG: pla:Plav_2814 response regulator
FT                   receiver protein; PFAM: response regulator receiver; SMART:
FT                   response regulator receiver; SPTR: Q12U95 Response
FT                   regulator receiver protein; PFAM: Response regulator
FT                   receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35829"
FT                   /db_xref="GOA:D5E9H8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9H8"
FT                   /protein_id="ADE35829.1"
FT                   /translation="MATILVVEDNPMNMELTVDLLESYGYEVMQAEDGSQALDVVEKNT
FT                   FDLILLDMQLPKMDGLEVLEKFKEIENSKDTPVVALTAHAMRGDDKKFINAGCAGYISK
FT                   PIDIHEFQQTISSYVDN"
     atggccacaa ttctggtagt tgaagacaat ccaatgaaca tggaacttac agtggatttg        60
     cttgaatctt acggatatga agtaatgcag gcagaggacg gttcacaggc tcttgatgtt       120
     gtagagaaaa atacttttga tctcatctta cttgatatgc agctgcccaa aatggatggg       180
     cttgaagttc tggaaaaatt caaagagatt gaaaattcaa aagatacgcc tgtagttgca       240
     ttgacagcac atgcaatgag gggcgatgat aagaaattta ttaatgcagg atgtgcggga       300
     tatatatcca aaccaatcga tatacatgaa ttccaacaaa ctatctcatc ttatgtcgac       360
     aattga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page