(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE293

CP001994.PE293       Location/Qualifiers
FT   CDS_pept        complement(318471..318812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0299"
FT                   /product="Protein of unknown function DUF356"
FT                   /note="COGs: COG1844 conserved hypothetical protein;
FT                   InterPro IPR007154; PFAM: Protein of unknown function
FT                   DUF356; SPTR: Q12U92 Putative uncharacterized protein;
FT                   PFAM: Protein of unknown function (DUF356)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35831"
FT                   /db_xref="InterPro:IPR007154"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9I0"
FT                   /protein_id="ADE35831.1"
FT                   /translation="MKSFAVIRGEDKNKVRIALHDLQQYGSMKFSSCPKRIEPNYADTL
FT                   LVKVVGVPLRSNCKFAALVGLENNAGSAINKLRKIHPPAHIVIISPRHDAYEELMDNSE
FT                   IYPEFEINN"
     atgaaatcct ttgcggtaat caggggagaa gacaaaaaca aagtcaggat tgcgctgcat        60
     gatttgcagc aatacgggag catgaaattc agttcctgtc caaaacgtat cgaaccaaac       120
     tatgcagaca ctcttcttgt aaaggttgtg ggagtaccct tgcgttcaaa ttgtaagttt       180
     gcagcgcttg taggcctgga aaataatgcc ggctctgcga ttaacaaact gagaaaaata       240
     catccaccag cccatattgt aataataagt cccaggcatg atgcttatga agaattaatg       300
     gataattctg agatatatcc tgaatttgaa ataaacaatt aa                          342
//

If you have problems or comments...

PBIL Back to PBIL home page