(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE294

CP001994.PE294       Location/Qualifiers
FT   CDS_pept        complement(318897..319715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0300"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="COGs: COG0345 Pyrroline-5-carboxylate reductase;
FT                   InterPro IPR011128:IPR004455:IPR006115:IPR000304; KEGG:
FT                   dat:HRM2_40670 ProC; PFAM: NADP oxidoreductase coenzyme
FT                   F420-dependent; NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase domain protein; 6-phosphogluconate
FT                   dehydrogenase NAD-binding; PRIAM: Pyrroline-5-carboxylate
FT                   reductase; SPTR: Q12U91 Pyrroline-5-carboxylate reductase;
FT                   TIGRFAM: pyrroline-5-carboxylate reductase; PFAM: NADP
FT                   oxidoreductase coenzyme F420-dependent; TIGRFAM:
FT                   pyrroline-5-carboxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35832"
FT                   /db_xref="GOA:D5E9I1"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9I1"
FT                   /protein_id="ADE35832.1"
FT                   /translation="MMHLENKKVGIIGTGKMGQSLLRGIVRAGKAKPANIYASDVYEPA
FT                   LQALKDELGINVSTDNFDTVDNSEIIILAVKPQILRNVLRGFADHINENKLIISIAAGV
FT                   PAATIEEELHEDTRVVRVMPNIAATVGEAASAVSAGKNASAEDAEVAMEIFSSMGSAAL
FT                   VPEHLMDAVTGVSGSGPAYIFPVIEAMADGGVLEGLDRESALKLAAQTVLGAAKMVLET
FT                   KKHPAELKDMVTSPAGTTIHGVHALEKNGIRAAFTDAVMASAKRSREMGK"
     atgatgcacc tcgaaaacaa gaaagtcggc ataataggga ccggcaagat ggggcaaagc        60
     ctgcttagag gcatagttcg tgcaggaaaa gcaaaacctg caaatatcta tgccagcgat       120
     gtttatgaac ctgcgctgca ggcacttaaa gatgaacttg gaattaacgt atcaacagat       180
     aactttgata ctgtggataa ttcagaaatc atcatccttg cggtcaaacc ccagatactt       240
     cgcaatgtac tacgaggttt tgcagaccat attaacgaaa acaaactcat aatttcaatt       300
     gcggcagggg ttcctgcagc caccattgaa gaggaattac acgaagatac aagagtcgtt       360
     cgtgtgatgc caaacattgc agcaaccgta ggcgaagcag cctctgcagt cagtgcaggg       420
     aaaaatgcat ccgcagaaga tgctgaagtc gcaatggaaa tattttcaag catgggttct       480
     gccgctcttg tacctgaaca tctcatggat gcggttacag gagtttcagg gagcggacct       540
     gcatatattt tccccgtgat cgaggctatg gcagacggcg gcgtgcttga aggacttgac       600
     agggaaagtg cactgaaact ggcagcccag acagtacttg gtgcagcaaa gatggtcctt       660
     gaaacaaaaa aacatccggc agaactcaag gacatggtga cttctcctgc agggacaacc       720
     atccacgggg ttcatgcact tgagaaaaac ggaataaggg cggcttttac agatgcagtg       780
     atggcttctg caaaacgctc ccgtgaaatg gggaaataa                              819
//

If you have problems or comments...

PBIL Back to PBIL home page