(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE296

CP001994.PE296       Location/Qualifiers
FT   CDS_pept        320290..321579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0302"
FT                   /product="Proteasome-activating nucleotidase"
FT                   /EC_number="3.6.1.3"
FT                   /note="COGs: COG1222 ATP-dependent 26S proteasome
FT                   regulatory subunit;
FT                   InterProIPR003959:IPR011704:IPR003593:IPR003960:IPR 005937;
FT                   KEGG: hypothetical protein; K03062 26S proteasome
FT                   regulatory subunit T2; PFAM: AAA ATPase central domain
FT                   protein; ATPase associated with various cellular activities
FT                   AAA_5; PRIAM: Adenosinetriphosphatase; SMART: AAA ATPase;
FT                   SPTR: Q12U89 26S proteasome subunit P45 family; TIGRFAM:
FT                   26S proteasome subunit P45 family; PFAM: ATPase family
FT                   associated with various cellular activities (AAA); TIGRFAM:
FT                   26S proteasome subunit P45 family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35834"
FT                   /db_xref="GOA:D5E9I3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="InterPro:IPR023501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032501"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9I3"
FT                   /protein_id="ADE35834.1"
FT                   /translation="MNETSDDTLNQGNYGLKNMSDIEYDYMGSEGDEDFSKYLLDRMKQ
FT                   LESRNSKLKEQCDQIESEKKYVESQKVKYEREVRKLRSEINRLKTVPLIVANIIDVIDS
FT                   NKVLIRSSSGPQFMVGVSQYIDDSRLVAGVRVALNQQTLSIVDVLPSTEEPEVSAMEVL
FT                   ESQDISYEDIGGLDNQIQDIIECVELPLIKPESFERVGVEPPKGVLLHGPPGTGKTMMA
FT                   KAVAHRTDATFIRVVGSELVQKYIGEGSRLVREVFDMARKKAPSIIFIDELDAIAATRL
FT                   SDTNGADREVQRTLMQLLAEMDGFENRGDIRIIAATNRVDILDPAIIRPGRFDRMVEVP
FT                   MPDTESRSLILRIHSRGLSLALDVDFDKLATLTENTSGADLHALTTEAGMFAVRNDRDS
FT                   VTMADFMAAIDKVLKPRQPQVNEHPASMFV"
     atgaacgaaa cgagtgatga tacgttaaat caggggaatt acggattaaa aaatatgtcc        60
     gatattgaat atgattatat gggttctgaa ggagacgaag acttttcaaa gtaccttctg       120
     gacaggatga agcaacttga atcccgcaac agcaaactta aagagcagtg cgaccaaatc       180
     gaatctgaaa aaaagtatgt agaatcccag aaagtgaagt atgaaaggga agttcgcaaa       240
     cttcgctctg agattaacag gcttaagact gttcctttga tcgtggcaaa tatcattgat       300
     gtcattgact ccaataaagt cttgatacga agcagttcgg gcccccagtt catggtaggg       360
     gtttcccagt acatagatga ttccagattg gttgccggtg tcagggttgc cctgaaccag       420
     cagacccttt caatagtgga tgttcttccc tcgacagaag aaccggaagt ttcagcaatg       480
     gaagtcctgg aatctcagga tataagctat gaagatatcg gtggactgga taatcagatt       540
     caggatatca ttgaatgtgt cgaacttcct ctcattaaac ccgagtcttt tgaacgcgtg       600
     ggtgtggaac ctcccaaagg tgtgctgctg cacggcccgc cgggtaccgg taaaacgatg       660
     atggcaaaag cggttgccca tcgtactgac gcaactttca tccgtgttgt gggctcggaa       720
     cttgtgcaaa agtacattgg cgaaggttcc agactggtca gggaagtttt cgatatggca       780
     agaaagaaag ctccaagcat tattttcata gatgagctgg atgccattgc agcaacccgg       840
     ctgagtgaca ccaacggtgc tgacagggaa gtacagcgca ctctcatgca acttcttgcg       900
     gagatggatg gatttgagaa ccgaggtgat attcgtataa ttgcagctac caacagggtg       960
     gatatccttg atcctgccat aattcgtccg ggtcgctttg ataggatggt agaggttccg      1020
     atgccggata cagaatctcg tagcttgatc ctcaggattc attccagagg gctttccctt      1080
     gccctggatg tggactttga caaacttgcc acccttacag aaaatacgag tggtgcggat      1140
     ctgcatgcac tgactaccga ggcaggtatg tttgctgtac gcaatgatcg tgatagtgtg      1200
     acaatggctg actttatggc tgccattgat aaggtcctaa agccccgcca acctcaggtt      1260
     aatgagcatc cagcctcaat gtttgtttaa                                       1290
//

If you have problems or comments...

PBIL Back to PBIL home page