(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE297

CP001994.PE297       Location/Qualifiers
FT   CDS_pept        321699..322181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0303"
FT                   /product="protein of unknown function DUF99"
FT                   /note="COGs: COG1628 conserved hypothetical protein;
FT                   InterPro IPR002802; KEGG: dol:Dole_2350 hypothetical
FT                   protein; PFAM: protein of unknown function DUF99; SPTR:
FT                   Q8PY57 UPF0215 protein MM_1007; PFAM: Protein of unknown
FT                   function DUF99"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35835"
FT                   /db_xref="InterPro:IPR002802"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9I4"
FT                   /protein_id="ADE35835.1"
FT                   /translation="MWLDGVLSTYITRDGMDATDSLIKMISASKHRNQARVIMLDGVTY
FT                   GGFNPIDIVRLNESTGMGVIVLMRSMPDFENIKNALYHLEYPDERFAIIKKAGRISRVV
FT                   TSHSHTPVYIQCAGIDEISATRIVQLSATHSNIPEPLRVAHLIATGIICGESCGKP"
     atgtggcttg acggagtgtt atccacctac attaccaggg atggtatgga tgctaccgat        60
     tcattaataa agatgatatc agccagcaaa cacaggaatc aggcgcgtgt gataatgctg       120
     gatggagtca catacggtgg tttcaatccg attgatatcg tgcgtttaaa tgaatctaca       180
     ggaatgggtg tgattgtgct gatgcgctcg atgcctgatt ttgagaatat aaaaaatgct       240
     ctatatcatc tggaataccc ggatgaaagg tttgcgataa taaaaaaagc aggcaggata       300
     tcgagggtgg taacttcaca ttcccatacg ccggtttaca tccagtgtgc aggcatcgat       360
     gaaatttccg ccaccaggat agtccagtta agtgccaccc atagcaatat tccagagcct       420
     ttgagggttg cacatctcat tgccacaggt attatttgtg gtgaatcctg cggtaaacct       480
     tga                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page