(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE298

CP001994.PE298       Location/Qualifiers
FT   CDS_pept        complement(322187..323533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0304"
FT                   /product="phosphomannomutase; alpha-phosphoglucomutase"
FT                   /EC_number="5.4.2.8"
FT                   /EC_number="5.4.2.2"
FT                   /EC_number="5.4.2.10"
FT                   /note="COGs: COG1109 Phosphomannomutase;
FT                   InterProIPR005841:IPR005844:IPR005846:IPR005843:IPR
FT                   005845:IPR016066; KEGG:
FT                   Phosphoglucomutase/phosphomannomutase, C-terminal domain
FT                   containing protein; K01840 phosphomannomutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III;
FT                   phosphoglucomutase/phosphomannomutase;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; PRIAM: Phosphoglucosamine mutase; SPTR: Q12U88
FT                   Phosphoglucosamine mutase; PFAM:
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain II; Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain III;
FT                   Phosphoglucomutase/phosphomannomutase, C-terminal domain;
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain I"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35836"
FT                   /db_xref="GOA:D5E9I5"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR024086"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9I5"
FT                   /protein_id="ADE35836.1"
FT                   /translation="MGLFGTNGVRGIANEFITPKFAIDLARSLGTHLGEDKTVAIGRDT
FT                   RISGEMLKAAAISGLLSTGIKVIDIGTCPTPSVQYYVRDYADAGIVITASHNPREYNGI
FT                   KLIAADGTEFSKEGEKKVENIYYSGEFHTANWNMTGELNRDYNANDYYINGIISSVNST
FT                   KISAKQFRVAIDTGCGAGSLTLPLLLRKLGCEVITINAQPDGTFPWRNPEPTPDVLGEL
FT                   RDIVKNYDVDLGVAQDGDADRAVFFDENGTFIDEEILLSMMAKYVISGKKGPIVTPVSS
FT                   SRRMLDIAKEAGVELHWTAVGSINVARRMMEIDAVFGGEGNGGLIFPEHQYCRDGAMAC
FT                   AKLLDIMAEGVKPSQMAANVPAYHNAKTKVKCGNLKKTLENVAIHVQGEGIEIDTTDGF
FT                   KIWYEDGWLLIRPSGTEPIVRVFAEAKTEKKARQILERGEKIVLASIQD"
     atgggcctgt ttggaaccaa cggagtacgt ggtatagcta acgaattcat tacacctaaa        60
     tttgcaatcg accttgccag aagtctggga acccatctgg gagaagataa aactgtagca       120
     atcggaagag atacacgcat ctcaggagag atgctaaaag cagctgcaat atccggttta       180
     ctttcaacgg gcataaaagt tatcgacatt ggaacctgcc ccacaccgtc tgtccagtat       240
     tatgtgcgcg attatgcaga tgctggaatt gttattactg catcccacaa ccccagggaa       300
     tataatggca taaaacttat agccgcagat ggtaccgaat tttccaaaga gggggagaaa       360
     aaggtcgaaa atatctacta cagcggcgaa ttccacactg ctaactggaa catgacaggt       420
     gaacttaacc gggattataa tgccaatgat tactacatca atggaataat ctcatcggtc       480
     aattccacaa aaatcagcgc aaaacaattt cgagtggcca tagatacggg atgtggtgca       540
     ggttctctca cattacccct cttattgcgt aaactgggat gtgaggtcat aacgatcaac       600
     gcccagccgg atggcacttt cccctggaga aatcccgagc caacacccga tgtactggga       660
     gaactcaggg atattgtcaa aaattacgat gttgacctgg gagttgctca ggacggggat       720
     gcagacaggg cagtcttctt tgatgaaaat ggtactttca ttgatgaaga aatactgctt       780
     tccatgatgg caaaatatgt gatctccggt aaaaagggac caatcgtgac accggtcagt       840
     tcatcccggc gcatgctgga cattgcaaaa gaagcaggcg tagaactcca ctggacagcc       900
     gtaggatcca ttaatgtagc acgcaggatg atggaaatcg acgctgtttt tggcggagaa       960
     ggcaatggag gacttatttt cccggaacac cagtactgca gggacggtgc aatggcctgt      1020
     gccaaattac ttgacataat ggcagaggga gtgaaacctt cacagatggc tgcaaatgtt      1080
     ccggcatacc ataatgccaa aacaaaggta aaatgtggta atctgaaaaa aacgcttgaa      1140
     aacgtagcca tccacgtaca gggagaagga attgagattg ataccaccga tggtttcaag      1200
     atatggtatg aagacgggtg gctactgata cgcccctccg gtaccgaacc aattgtcagg      1260
     gtctttgccg aagctaaaac ggagaaaaag gcaaggcaga ttctggaaag aggggaaaag      1320
     atagtactgg cttcaatcca ggattaa                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page