(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE300

CP001994.PE300       Location/Qualifiers
FT   CDS_pept        complement(323963..324136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0306"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q12U86 Preprotein translocase subunit secG;
FT                   PFAM: Sec61beta family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35838"
FT                   /db_xref="GOA:D5E9I7"
FT                   /db_xref="InterPro:IPR016482"
FT                   /db_xref="InterPro:IPR023531"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9I7"
FT                   /protein_id="ADE35838.1"
FT                   /translation="MGKKKQSNNGLMSSAGLMRYYEEDKRAIHLDPKAVIVFGLLCGLA
FT                   VILLSASYGTWP"
     atgggaaaaa agaaacagag taacaacggt ttgatgtcct ctgccggtct tatgagatat        60
     tatgaagagg ataaaagggc aatccacctg gaccccaaag cagttatagt ctttggattg       120
     ctttgtggac ttgctgttat tctcttaagc gccagttatg gcacctggcc ataa             174
//

If you have problems or comments...

PBIL Back to PBIL home page