(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE304

CP001994.PE304       Location/Qualifiers
FT   CDS_pept        328023..329501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0310"
FT                   /product="cysteine-rich small domain protein"
FT                   /note="COGs: COG0079 Histidinol-phosphate/aromatic
FT                   aminotransferase and cobyric acid decarboxylase; InterPro
FT                   IPR007212:IPR004839; KEGG: ppd:Ppro_0869 putative
FT                   L-threonine-O-3-phosphate decarboxylase; PFAM:
FT                   cysteine-rich small domain; aminotransferase class I and
FT                   II; SPTR: Q12UB3 L-threonine O-3-phosphate decarboxylase;
FT                   PFAM: Aminotransferase class I and II; Cysteine-rich small
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35842"
FT                   /db_xref="GOA:D5E9J1"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR007212"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9J1"
FT                   /protein_id="ADE35842.1"
FT                   /translation="MSGKGLWKKSVESIRKPLEDGHRIALEKGISETAIIDFSSTSNPM
FT                   GSPFDHPGCKLCLEDLFSRVGSMYSHFHDNEYSELRASAAKYFGKNISADNIVPALGVE
FT                   DVIRMVSSSVIETGDTVILSRSQNPANEKHCIISGGEVRYVFEEDFKNISSDVLNKAKI
FT                   ILLTNPDNLSGQLYSKKDLISLLQRCNVHSTLLVVDESLLDLTDVSATLVDEVPSVTNL
FT                   LVIRSLKNTFSLPGAGISFGITDVDFATILNRVRNCCNIGPMDEAVALSLLDMPSDIAN
FT                   DYLTASRQFVRENRQYLMERLGKVRRFIPHESNTSFVLVDVSAASLDSVELTHRLAEKG
FT                   LLVRDCSCFYSMDRNFIRVSVRPKEDTDRLVEAIGTVVVDSARDSAMENLNQILDEEPV
FT                   RPLGANTACPYYPCHFKGQDCTFCFCPFYPCGDERTGGRWVCRSSGGRVWSCEKCGLVH
FT                   KKQNVQKLLDVLKGEGEMEDKLKKAWDEVMEPLL"
     gtgtctggta agggattatg gaaaaaaagt gttgaatcaa tcaggaaacc tttagaagat        60
     ggacatagaa ttgccctgga aaaaggtatt agtgaaacag ctataattga ttttagttcg       120
     acatccaatc ctatgggcag tccctttgat cacccgggtt gcaaactctg tctggaagat       180
     cttttttccc gtgtgggatc catgtattcc cacttccatg ataatgaata ttcagaatta       240
     agggccagtg ctgccaaata ttttggaaaa aatatttctg ctgataacat tgttcctgct       300
     ctgggagttg aagatgtaat acgcatggta tcttcctcgg taattgaaac aggggatacc       360
     gttattctga gcaggtcgca gaaccctgcc aatgaaaaac attgtataat cagtggtggg       420
     gaagtgaggt atgtttttga ggaggatttt aaaaacatat catcagatgt gcttaacaag       480
     gcaaaaataa tcctgcttac caaccctgac aatctttcag gccagcttta ttcaaaaaag       540
     gatttgattt ctcttctaca acgctgtaat gtccattcca ccctgctggt ggtcgatgaa       600
     agcctgttag acttaacaga cgtatctgcc actttggttg atgaagtacc ttctgttacc       660
     aatcttctgg tgatacgctc cctgaaaaac accttttccc ttcccggggc aggaatctct       720
     tttggtatta ctgatgtgga ttttgcaacg attctgaaca gggtccgcaa ctgctgcaat       780
     atagggccaa tggatgaagc agttgctctg tccttgttgg atatgccttc cgatattgcg       840
     aatgattatc tgactgcttc aagacaattt gtccgggaaa accgccagta tcttatggaa       900
     cggctgggca aggtgcgcag gttcatacca catgaaagta atacatcctt tgtacttgtt       960
     gatgtaagcg ctgcgagtct cgattcggtc gaattgactc acaggcttgc tgaaaagggt      1020
     cttcttgtaa gggattgttc ctgcttttat tccatggatc gtaattttat cagggtctcg      1080
     gtgagaccga aagaggatac tgataggctt gtggaggcta tagggacagt cgtagttgac      1140
     agtgcccggg atagtgccat ggagaacctt aaccagatac tggacgaaga acccgtcagg      1200
     cctcttggtg ctaacacggc ctgtccatat tatccctgcc atttcaaggg tcaggattgc      1260
     actttctgtt tttgcccctt ttatccctgc ggggatgagc gcacaggagg caggtgggtt      1320
     tgtcgctcaa gtggaggtag ggtgtggagt tgtgaaaaat gtggtctggt ccacaaaaaa      1380
     caaaatgtac agaaactcct tgatgtcctc aaaggtgagg gggagatgga agacaaactc      1440
     aaaaaagcct gggatgaggt aatggagccc ctattatga                             1479
//

If you have problems or comments...

PBIL Back to PBIL home page