(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE308

CP001994.PE308       Location/Qualifiers
FT   CDS_pept        331912..332529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0314"
FT                   /product="adenosylcobinamide-phosphate guanylyltransferase"
FT                   /EC_number="2.7.7.62"
FT                   /note="COGs: COG2266 GTP:adenosylcobinamide-phosphate
FT                   guanylyltransferase; KEGG: swp:swp_4982
FT                   molybdopterin-guanine dinucleotide biosynthesis protein;
FT                   SPTR: Q12UA9 Putative nucleotidyltransferase; PFAM:
FT                   Uncharacterized protein family UPF0007; TIGRFAM: conserved
FT                   hypothetical protein TIGR00454"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35846"
FT                   /db_xref="GOA:D5E9J5"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9J5"
FT                   /protein_id="ADE35846.1"
FT                   /translation="MDAFIMAGGQGLRLGMGEKPCVDILGKPMICYVVDALEESESIGD
FT                   VYVTVSPFTPHTEEVIENRYGGNVKTIDTAGDNYVGDMVYAVEQANVAEPLMVIMSDLP
FT                   LITADLIDSIVEEYYRCGKPSMSVFIPLSLCKKVGLRPDTVFNWSGNLIVPTGINILDG
FT                   SKIREEQEYYNYLLEDPEVALNVNTAEDLQRCTDILEKRQNK"
     atggatgctt ttataatggc cggtggacag ggtttgcgcc tgggtatggg cgagaaaccc        60
     tgtgtggata ttctgggtaa acccatgata tgttatgttg tggatgccct ggaggagtca       120
     gaaagcattg gtgatgttta tgtgacagta tctcctttca cccctcacac cgaagaagtt       180
     atagaaaatc gttatggggg caatgtcaaa accattgata ctgccggtga taattatgtt       240
     ggtgatatgg tttatgctgt ggaacaggct aacgttgcag aacccctgat ggtaatcatg       300
     tctgacctgc ccctgataac agccgatctt attgattcca ttgtggagga atactacagg       360
     tgtggaaaac cttcaatgtc ggtatttata cccctttccc tctgtaaaaa agtgggtctg       420
     cgtccggata ccgttttcaa ctggagtgga aaccttatag ttcccactgg aataaatatc       480
     cttgacggaa gcaaaatccg ggaggaacag gaatattata attatctact ggaagaccct       540
     gaagtagccc tgaatgtcaa tactgcagag gatttgcagc gctgcactga tattctggaa       600
     aaaaggcaga ataaataa                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page