(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE315

CP001994.PE315       Location/Qualifiers
FT   CDS_pept        338567..339451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0321"
FT                   /product="thiamine-phosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="COGs: COG0611 Thiamine monophosphate kinase;
FT                   InterPro IPR010918:IPR000728:IPR006283; KEGG: dal:Dalk_0686
FT                   thiamine-monophosphate kinase; PFAM: AIR synthase related
FT                   protein; AIR synthase related protein domain protein;
FT                   PRIAM: Thiamine-phosphate kinase; SPTR: Q12U75
FT                   Thiamine-monophosphate kinase; TIGRFAM:
FT                   thiamine-monophosphate kinase; PFAM: AIR synthase related
FT                   protein, N-terminal domain; AIR synthase related protein,
FT                   C-terminal domain; TIGRFAM: thiamine-monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35853"
FT                   /db_xref="GOA:D5E9K2"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9K2"
FT                   /protein_id="ADE35853.1"
FT                   /translation="MTAVLEFGGEYLVVTTDMLHQKTDFPDTMTPWQIGWMAAAVNFSD
FT                   IAAMGGQPLGLLAAVGYPQNMSLEDAGEIARGMRDCAEFCGTSVIGGDVDSHEELTVTG
FT                   TAMGRVSKEELLTRKGAKPGDLLCVTATLGGAGAALEAYLKNMNVDDDFMKPLLEPVPR
FT                   IAEGRKLAKSGAVTSAMDTSDGLALSLYDLASVNKVGFVLKEESLPIDKRVFEIATSKK
FT                   EALEMALYSGGDFELLVTVSKDKFKALQAESYLTVVGEVVDIDGAISLIGKDGANFAID
FT                   RKGYLHMGTSDQI"
     atgactgcag tccttgaatt tggcggggag taccttgtgg ttactacgga catgttgcac        60
     cagaagaccg actttcccga tacaatgact ccctggcaga tcggctggat ggctgctgcg       120
     gtgaatttca gtgatattgc tgcaatgggc ggccagcctc tgggtttgct tgcagctgtg       180
     ggctatcccc aaaacatgtc tctggaagac gccggggaaa tcgcccgggg aatgcgagat       240
     tgtgcagaat tctgtggcac ttcggtaatc gggggagatg tggattccca tgaggaactt       300
     actgtcacag gaactgccat gggcagggtt tccaaagaag aacttctcac ccgcaaaggc       360
     gcaaaaccgg gtgacctgct ctgtgttact gccaccctgg gaggagccgg ggcagccctg       420
     gaggcctatc tgaaaaatat gaatgttgat gatgatttca tgaaacccct gctggaaccg       480
     gtcccccgga ttgccgaggg cagaaagctt gcaaaaagcg gtgctgtgac ctctgccatg       540
     gataccagcg acgggctggc actgtcgctg tatgatcttg catctgttaa taaagtggga       600
     tttgtcctga aggaagaatc cctgccaata gacaagcgtg tgtttgagat tgctacaagc       660
     aagaaagaag ccctggaaat ggcactgtat tcaggcgggg atttcgagtt attggtaacg       720
     gtttcaaagg ataagttcaa agcgttacag gccgaatctt atttaactgt tgtaggagaa       780
     gttgttgaca ttgatggggc tattagtttg attggcaaag atggggcaaa ctttgctatt       840
     gatcgaaaag gttatttaca tatgggaaca tctgatcaga tatga                       885
//

If you have problems or comments...

PBIL Back to PBIL home page